Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionCytochromes P450 are a group of heme-thiolate monooxygenases. They oxidize a variety of structurally unrelated compounds, including steroids, fatty acids, and xenobiotics.
ProductProbable cytochrome P450 125 Cyp125
CommentsRv3545c, (MT3649, MTCY03C7.11), len: 433 aa. Probable cyp125, cytochrome P-450, similar to others e.g. Q59723|LINC|CYP111 from Pseudomonas incognita (406 aa), FASTA scores: opt: 831, E(): 8e-45, (34.75% identity in 406 aa overlap); Q9X8Q3|CYP107P1|SCH10.14c from Streptomyces coelicolor (411 aa), FASTA scores: opt: 694, E(): 3.3e-36, (32.35% identity in 417 aa overlap); Q9L465|CYP162A1|NIKQ from Streptomyces tendae (396 aa) FASTA scores: opt: 664, E(): 2.5e-34, (34.15% identity in 413 aa overlap); O08469|CPXY_BACSU|CYPA|CYP107J1 from Bacillus subtilis (410 aa), FASTA scores: opt: 579, E(): 5.6e-29, (30.05% identity in 366 aa overlap); etc. Also similar to other from Mycobacterium tuberculosis e.g. Q50696|CYP124|Rv2266|MT2328|MTCY339.44c (428 aa) FASTA scores: opt: 1040, E(): 6.1e-58, (40.75% identity in 432 aa overlap). Belongs to the cytochrome P450 family.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified by mass spectrometry in the culture filtrate and whole cell lysates of M. tuberculosis H37Rv but not the membrane protein fraction (See de Souza et al., 2011).
OperonRv3540c, Rv3541c, Rv3542c, Rv3543c, Rv3544c, and Rv3545c are co-transcribed, by RT-PCR (See Chang et al., 2007).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for growth in C57BL/6J mouse spleen, by transposon site hybridization (TraSH) in H37Rv (See Sassetti and Rubin, 2003). Non-essential gene for in vitro growth of H37Rv, but essential for in vitro growth on cholesterol; by sequencing of Himar1-based transposon mutagenesis (See Griffin et al., 2011). H37Rv Rv3540c-Rv3545c mutant is attenuated for growth in mouse macrophages and during the early stages of infection in mice (See Chang et al., 2007). M. tuberculosis H37Rv Rv3540c-Rv3545c mutant is unable to grow in minimal medium with cholesterol but can still perform initial steps of cholesterol degradation; in vitro growth defect is partially complemented by having additional mutation in yrbE4a|Rv3501c; reduced CFU of Rv3540c-Rv3545c mutant in C57BL/6 mouse lungs and spleen is complemented by having additional mutation in yrbE4a|Rv3501c (See Chang et al., 2009).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS39841443985445-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3545c|cyp125
VSWNHQSVEIAVRRTTVPSPNLPPGFDFTDPAIYAERLPVAEFAELRSAAPIWWNGQDPGKGGGFHDGGFWAITKLNDVKEISRHSDVFSSYENGVIPRFKNDIAREDIEVQRFVMLNMDAPHHTRLRKIISRGFTPRAVGRLHDELQERAQKIAAEAAAAGSGDFVEQVSCELPLQAIAGLLGVPQEDRGKLFHWSNEMTGNEDPEYAHIDPKASSAELIGYAMKMAEEKAKNPADDIVTQLIQADIDGEKLSDDEFGFFVVMLAVAGNETTRNSITQGMMAFAEHPDQWELYKKVRPETAADEIVRWATPVTAFQRTALRDYELSGVQIKKGQRVVMFYRSANFDEEVFQDPFTFNILRNPNPHVGFGGTGAHYCIGANLARMTINLIFNAVADHMPDLKPISAPERLRSGWLNGIKHWQVDYTGRCPVAH