Gene Rv3550
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Could possibly oxidize fatty acids using specific components [catalytic activity: (3S)-3-hydroxyacyl-CoA = trans-2(or 3)-enoyl-CoA + H(2)O]. |
| Product | Probable enoyl-CoA hydratase EchA20 (enoyl hydrase) (unsaturated acyl-CoA hydratase) (crotonase) |
| Comments | Rv3550, (MTCY03C7.06c), len: 247 aa. Probable echA20, enoyl-CoA hydratase, similar to others e.g. Q9A7B0|CC1814 from Caulobacter crescentus (275 aa), FASTA scores: opt: 488, E(): 3.5e-24, (36.4% identity in 239 aa overlap); O84978|PHAA from Pseudomonas putida (293 aa), FASTA scores: opt: 383, E(): 2e-17, (33.85% identity in 254 aa overlap); BAB48479|Q98LI4|MLL1009 from Rhizobium loti (Mesorhizobium loti) (258 aa), FASTA scores: opt: 378, E(): 3.8e-17, (21.45% identity in 231 aa overlap); etc. Could belong to the enoyl-CoA hydratase/isomerase family. |
| Functional category | Lipid metabolism |
| Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 3989153 | 3989896 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3550|echA20
MPITSTTPEPGIVAVTVDYPPVNAIPSKAWFDLADAVTAAGANSDTRAVILRAEGRGFNAGVDIKEMQRTEGFTALIDANRGCFAAFRAVYECAVPVIAAVNGFCVGGGIGLVGNSDVIVASEDATFGLPEVERGALGAATHLSRLVPQHLMRRLFFTAATVDAATLQHFGSVHEVVSRDQLDEAALRVARDIAAKDTRVIRAAKEALNFIDVQRVNASYRMEQGFTFELNLAGVADEHRDAFVKKS
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
