Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductPossible conserved lipoprotein LppH
CommentsRv3576, (MTCY06G11.23), len: 237 aa. Possible lppH, conserved lipoprotein, similar in part with proteins from Mycobacterium tuberculosis; C-terminus of Q11053|PKNH_MYCTU|PKNH|Rv1266c|MT1304|MTCY50.16 probable serine/threonine-protein kinase (626 aa) FASTA scores: opt: 396, E(): 6.5e-19, (36.0% identity in 200 aa overlap); and with P71740|LPPR|Rv2403c|MTCY253.17 probable lipoprotein protein (251 aa), FASTA scores: opt: 134, E(): 0.087, (22.7% identity in 207 aa overlap). Contains PS00013 Prokaryotic membrane lipoprotein lipid attachment site. Note that previously known as pknM.
Functional categoryCell wall and cell processes
ProteomicsIdentified in the detergent phase of Triton X-114 extracts of M. tuberculosis H37Rv membranes using 1-DGE and MALDI-TOF-MS (See Sinha et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS40183584019071+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3576|lppH
VGKQLAALAALVGACMLAAGCTNVVDGTAVAADKSGPLHQDPIPVSALEGLLLDLSQINAALGATSMKVWFNAKAMWDWSKSVADKNCLAIDGPAQEKVYAGTGWTAMRGQRLDDSIDDSKKRDHYAIQAVVGFPTAHDAEEFYSSSVQSWSSCSNRRFVEVTPGQDDAAWTVADVVNDNGMLSSSQVQEGGDGWTCQRALTARNNVTIDIVTCAYSQPDLVAIGIANQIAAKVAKQ