Gene Rv3576 (pknM)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible conserved lipoprotein LppH |
| Comments | Rv3576, (MTCY06G11.23), len: 237 aa. Possible lppH, conserved lipoprotein, similar in part with proteins from Mycobacterium tuberculosis; C-terminus of Q11053|PKNH_MYCTU|PKNH|Rv1266c|MT1304|MTCY50.16 probable serine/threonine-protein kinase (626 aa) FASTA scores: opt: 396, E(): 6.5e-19, (36.0% identity in 200 aa overlap); and with P71740|LPPR|Rv2403c|MTCY253.17 probable lipoprotein protein (251 aa), FASTA scores: opt: 134, E(): 0.087, (22.7% identity in 207 aa overlap). Contains PS00013 Prokaryotic membrane lipoprotein lipid attachment site. Note that previously known as pknM. |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified in the detergent phase of Triton X-114 extracts of M. tuberculosis H37Rv membranes using 1-DGE and MALDI-TOF-MS (See Sinha et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4018358 | 4019071 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3576|lppH
VGKQLAALAALVGACMLAAGCTNVVDGTAVAADKSGPLHQDPIPVSALEGLLLDLSQINAALGATSMKVWFNAKAMWDWSKSVADKNCLAIDGPAQEKVYAGTGWTAMRGQRLDDSIDDSKKRDHYAIQAVVGFPTAHDAEEFYSSSVQSWSSCSNRRFVEVTPGQDDAAWTVADVVNDNGMLSSSQVQEGGDGWTCQRALTARNNVTIDIVTCAYSQPDLVAIGIANQIAAKVAKQ
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Sinha S, Kosalai K, Arora S, Namane A, Sharma P, Gaikwad AN, Brodin P and Cole ST [2005]. Immunogenic membrane-associated proteins of Mycobacterium tuberculosis revealed by proteomics. Proteomics
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
