Gene Rv3577
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv3577, (MTCY06G11.24), len: 288 aa (other start sites possible upstream; equivalent to AAK48041 from Mycobacterium tuberculosis strain CDC1551 (379 aa) but shorter 91 aa). Hypothetical protein, showing some similarity to Q9RI88|SCJ11.16c hypothetical 37.9 KDA protein from Streptomyces coelicolor (349 aa) FASTA scores: opt: 285, E(): 1.5e-10, (27.45% identity in 266 aa overlap). |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Transcriptomics | DNA microarrays show increased expression in M. tuberculosis H37Rv in BALB/c mice compared to SCID mice, after 21 days of infection (See Talaat et al., 2004). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4019262 | 4020128 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3577|Rv3577
VPTARSDAPLSVTWMGVATLLVDDGSSALMTDGYFSRPGLARVAAGKVSPSAERVDGCLARANVSRLTAVIPVHTHIDHAMDSALVADRTGAQLVGGESAANVGRGYGLPEESLVVAVPGEPIQLGAFDVTLVESHHCPPDRFPGVISAPLTPPVKASAYRCGEAWSTLVHHRPSGRRLLIQDSAGFVSGALAGYRADAAYLSVGQLGLQPPSYLLEYWTETVRTVGVRRVILIHWDDFFRPLSKPLRALPYAADDLDLSIRILDELAAQDGVALQMPTVWRREDPWM
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Talaat AM et al. [2004]. The temporal expression profile of Mycobacterium tuberculosis infection in mice. Transcriptome
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
