Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv3577, (MTCY06G11.24), len: 288 aa (other start sites possible upstream; equivalent to AAK48041 from Mycobacterium tuberculosis strain CDC1551 (379 aa) but shorter 91 aa). Hypothetical protein, showing some similarity to Q9RI88|SCJ11.16c hypothetical 37.9 KDA protein from Streptomyces coelicolor (349 aa) FASTA scores: opt: 285, E(): 1.5e-10, (27.45% identity in 266 aa overlap).
Functional categoryConserved hypotheticals
ProteomicsIdentified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005).
TranscriptomicsDNA microarrays show increased expression in M. tuberculosis H37Rv in BALB/c mice compared to SCID mice, after 21 days of infection (See Talaat et al., 2004).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS40192624020128+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3577|Rv3577
VPTARSDAPLSVTWMGVATLLVDDGSSALMTDGYFSRPGLARVAAGKVSPSAERVDGCLARANVSRLTAVIPVHTHIDHAMDSALVADRTGAQLVGGESAANVGRGYGLPEESLVVAVPGEPIQLGAFDVTLVESHHCPPDRFPGVISAPLTPPVKASAYRCGEAWSTLVHHRPSGRRLLIQDSAGFVSGALAGYRADAAYLSVGQLGLQPPSYLLEYWTETVRTVGVRRVILIHWDDFFRPLSKPLRALPYAADDLDLSIRILDELAAQDGVALQMPTVWRREDPWM