Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionThought to be involved in transport of arsenic across the membrane (export): arsenic resistance by an export mechanism. Form the channel of an arsenite pump responsible for the translocation of the substrate across the membrane.
ProductPossible arsenical pump integral membrane protein ArsB2
CommentsRv3578, (MTCY06G11.25), len: 413 aa. Possible arsB2, arsenical pump integral membrane protein, similar to many e.g. Q9I1J6|ARSB|PA2278 from Pseudomonas aeruginosa (427 aa), FASTA scores: opt: 375, E(): 3.1e-15, (32.15% identity in 429 aa overlap); Q9K8K7|ARSB|BH2999 from Bacillus halodurans (436 aa), FASTA scores: opt: 360, E(): 2.5e-14, (28.7% identity in 432 aa overlap); P52146|ARB2_ECOLI from Escherichia coli (plasmid R46) (429 aa), FASTA scores: opt: 345, E(): 2e-13, (29.8% identity in 426 aa overlap); etc. Also highly similar to Q9KYM0|SC9H11.21c probable membrane efflux protein from Streptomyces coelicolor (446 aa), FASTA scores: opt: 730, E(): 1.7e-36, (53.95% identity in 443 aa overlap). Seems to belong to the ARS family.
Functional categoryCell wall and cell processes
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS40201424021383+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3578|arsB2
LTLAVALILLAVVLGFAVARPRGWPEAAAAVPAAVILLAIGAISPQQAMAQVSGLARVVAFLGAVLVLAKLCDDEGLFEAAGAAMARASAESHRLLRQVFAVSAAITAALCLDATVVLLTPVVLATVRRLRTPVRPYAYATAHLANAASLLLPVSNLTNLLAYHGAGISFTKFTLLMALPWLSAVAAVYVVFRWFFARDLRVVPDRQQLKPAPRLPMFVLVVVALTLGGFAVAESVGLAPTWAALAGAAVLALRSLRRGHTSVLRIARAVNVSFLVFVLALGVVVHAVMLNGMAARMSAVLPTGSGLPALLGIAALAAVLANVVNNLPATLVLVPLVAAGGPAAVLAVLLGVNIGPNLTYAGSLSNLLWRGVLRRHNVDASVGEYTRLGLCTVPAALAMAVLALWASAQVLGI