Gene Rv3578
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Thought to be involved in transport of arsenic across the membrane (export): arsenic resistance by an export mechanism. Form the channel of an arsenite pump responsible for the translocation of the substrate across the membrane. |
| Product | Possible arsenical pump integral membrane protein ArsB2 |
| Comments | Rv3578, (MTCY06G11.25), len: 413 aa. Possible arsB2, arsenical pump integral membrane protein, similar to many e.g. Q9I1J6|ARSB|PA2278 from Pseudomonas aeruginosa (427 aa), FASTA scores: opt: 375, E(): 3.1e-15, (32.15% identity in 429 aa overlap); Q9K8K7|ARSB|BH2999 from Bacillus halodurans (436 aa), FASTA scores: opt: 360, E(): 2.5e-14, (28.7% identity in 432 aa overlap); P52146|ARB2_ECOLI from Escherichia coli (plasmid R46) (429 aa), FASTA scores: opt: 345, E(): 2e-13, (29.8% identity in 426 aa overlap); etc. Also highly similar to Q9KYM0|SC9H11.21c probable membrane efflux protein from Streptomyces coelicolor (446 aa), FASTA scores: opt: 730, E(): 1.7e-36, (53.95% identity in 443 aa overlap). Seems to belong to the ARS family. |
| Functional category | Cell wall and cell processes |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4020142 | 4021383 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3578|arsB2
LTLAVALILLAVVLGFAVARPRGWPEAAAAVPAAVILLAIGAISPQQAMAQVSGLARVVAFLGAVLVLAKLCDDEGLFEAAGAAMARASAESHRLLRQVFAVSAAITAALCLDATVVLLTPVVLATVRRLRTPVRPYAYATAHLANAASLLLPVSNLTNLLAYHGAGISFTKFTLLMALPWLSAVAAVYVVFRWFFARDLRVVPDRQQLKPAPRLPMFVLVVVALTLGGFAVAESVGLAPTWAALAGAAVLALRSLRRGHTSVLRIARAVNVSFLVFVLALGVVVHAVMLNGMAARMSAVLPTGSGLPALLGIAALAAVLANVVNNLPATLVLVPLVAAGGPAAVLAVLLGVNIGPNLTYAGSLSNLLWRGVLRRHNVDASVGEYTRLGLCTVPAALAMAVLALWASAQVLGI
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
