Gene Rv3612c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv3612c, (MTCY07H7B.10), len: 109 aa. Conserved hypothetical protein. Residues 58 to 81 highly similar to N-terminal part of AAK46718|MT2424 hypothetical 3.9 KDA protein from Mycobacterium tuberculosis strain CDC1551 (36 aa), FASTA scores: opt: 108, E(): 0.38, (69.25% identity in 26 aa overlap). |
| Functional category | Conserved hypotheticals |
| Transcriptomics | mRNA identified by microarray analysis and up-regulated after 4h and 24h of starvation (see citation below). DNA microarrays show higher level of expression in M. tuberculosis H37Rv than in phoP|Rv0757 mutant (See Walters et al., 2006). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4053518 | 4053847 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3612c|Rv3612c
MVAVLTYARQLGFCRSTPPTIPHSRNQLVNKTAGQAAVAESWADRVSPGAVTHATGAMCPTLGAHQFEPNQVRCTACLTRTLSCRIFRRRRELPVVGLASGDPLHPALG
Bibliography
- Betts JC et al. [2002]. Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Transcriptome
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Walters SB et al. [2006]. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Transcriptome
- Maciag A et al. [2007]. Global analysis of the Mycobacterium tuberculosis Zur (FurB) regulon. Regulon
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
