Gene Rv3619c (ES6_1, Mtb9.9D)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Putative ESAT-6 like protein EsxV (ESAT-6 like protein 1) |
| Comments | Rv3619c, (MTCY15C10.33, MTCY07H7B.03, MT3721), len: 94 aa. EsxV, ESAT-6 like protein (see citations below), highly similar to many Mycobacterial ESAT-6 like proteins e.g. O53942|ES65_MYCTU putative ESAT-6 like protein 5 from Mycobacterium tuberculosis (94 aa), FASTA scores: opt: 582, E(): 4.4e-33, (92.55% identity in 94 aa overlap); Q49946|ES6X_MYCLE|U1756D putative ESAT-6 like protein X from Mycobacterium leprae (95 aa), FASTA scores: opt: 409, E(): 2.5e-21, (64.15% identity in 92 aa overlap); etc. Strictly identical to P96364|ES61_MYCTU|Rv1037c|MT1066|MTCY10G2.12 putative ESAT-6 like protein 1 (94 aa). Belongs to the ESAT6 family. A core mycobacterial gene; conserved in mycobacterial strains (See Marmiesse et al., 2004). |
| Functional category | Cell wall and cell processes |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4059984 | 4060268 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3619c|esxV
MTINYQFGDVDAHGAMIRAQAGSLEAEHQAIISDVLTASDFWGGAGSAACQGFITQLGRNFQVIYEQANAHGQKVQAAGNNMAQTDSAVGSSWA
Bibliography
- Tekaia F et al. [1999]. Analysis of the proteome of Mycobacterium tuberculosis in silico. Secondary
- Gey Van Pittius NC, Gamieldien J, Hide W, Brown GD, Siezen RJ and Beyers AD [2001]. The ESAT-6 gene cluster of Mycobacterium tuberculosis and other high G+C Gram-positive bacteria. Secondary Phylogeny
- Marmiesse M, Brodin P, Buchrieser C, Gutierrez C, Simoes N, Vincent V, Glaser P, Cole ST and Brosch R [2004]. Macro-array and bioinformatic analyses reveal mycobacterial 'core' genes, variation in the ESAT-6 gene family and new phylogenetic markers for the Mycobacterium tuberculosis complex. Homology
- [2009]. Systematic genetic nomenclature for type VII secretion systems. Nomenclature
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
