Gene Rv3620c (ES6_10, QILSS)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Putative ESAT-6 like protein EsxW (ESAT-6 like protein 10) |
| Comments | Rv3620c, (MTCY15C10.32, MTCY07H7B.02, MT3722), len: 98 aa. EsxW, ESAT-6 like protein (see citation below). Member of the M. tuberculosis hypothetical QILSS protein family with Rv1038c, Rv1792, Rv2347c and Rv1197|O05299|ES63_MYCTU|MT1235|MTCI364.09 putative ESAT-6 like protein 3 from Mycobacterium tuberculosis (98 aa), FASTA scores: opt: 638, E(): 2.3e-36, (97.95% identity in 98 aa overlap). Also similar to Q49945|ES6Y_MYCLE putative ESAT-6 like protein Y from Mycobacterium leprae (100 aa), FASTA scores: opt: 370, E(): 2.1e-18, (57.9% identity in 95 aa overlap); etc. Belongs to the ESAT6 family. |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4060295 | 4060591 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3620c|esxW
MTSRFMTDPHAMRDMAGRFEVHAQTVEDEARRMWASAQNISGAGWSGMAEATSLDTMTQMNQAFRNIVNMLHGVRDGLVRDANNYEQQEQASQQILSS
Bibliography
- Tekaia F et al. [1999]. Analysis of the proteome of Mycobacterium tuberculosis in silico. Secondary
- Gey Van Pittius NC, Gamieldien J, Hide W, Brown GD, Siezen RJ and Beyers AD [2001]. The ESAT-6 gene cluster of Mycobacterium tuberculosis and other high G+C Gram-positive bacteria. Secondary Phylogeny
- Mattow J, Schaible UE, Schmidt F, Hagens K, Siejak F, Brestrich G, Haeselbarth G, Muller EC, Jungblut PR and Kaufmann SH [2003]. Comparative proteome analysis of culture supernatant proteins from virulent Mycobacterium tuberculosis H37Rv and attenuated M. bovis BCG Copenhagen. Proteomics
- [2009]. Systematic genetic nomenclature for type VII secretion systems. Nomenclature
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant