Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionUnknown
ProductPutative ESAT-6 like protein EsxW (ESAT-6 like protein 10)
CommentsRv3620c, (MTCY15C10.32, MTCY07H7B.02, MT3722), len: 98 aa. EsxW, ESAT-6 like protein (see citation below). Member of the M. tuberculosis hypothetical QILSS protein family with Rv1038c, Rv1792, Rv2347c and Rv1197|O05299|ES63_MYCTU|MT1235|MTCI364.09 putative ESAT-6 like protein 3 from Mycobacterium tuberculosis (98 aa), FASTA scores: opt: 638, E(): 2.3e-36, (97.95% identity in 98 aa overlap). Also similar to Q49945|ES6Y_MYCLE putative ESAT-6 like protein Y from Mycobacterium leprae (100 aa), FASTA scores: opt: 370, E(): 2.1e-18, (57.9% identity in 95 aa overlap); etc. Belongs to the ESAT6 family.
Functional categoryCell wall and cell processes
ProteomicsIdentified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry (See Mattow et al., 2003).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS40602954060591-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3620c|esxW
MTSRFMTDPHAMRDMAGRFEVHAQTVEDEARRMWASAQNISGAGWSGMAEATSLDTMTQMNQAFRNIVNMLHGVRDGLVRDANNYEQQEQASQQILSS