Gene Rv3654c
in Mycobacterium tuberculosis H37Rv
General annotation
Type | CDS |
Function | Function unknown |
Product | Conserved hypothetical protein |
Comments | Rv3654c, (MTV025.002c), len: 84 aa. Hypothetical protein, similar to C-terminus of Q9X916|SCH5.14c membrane spanning protein from Streptomyces coelicolor (230 aa) FASTA scores: opt: 176, E(): 2.4e-05, (47.0% identity in 83 aa overlap). Equivalent to AAK48118 from Mycobacterium tuberculosis strain CDC1551 but shorter 18 aa. |
Functional category | Conserved hypotheticals |
Transcriptomics | mRNA identified by DNA microarray analysis and up-regulated at high temperatures, and possibly down-regulated by hspR|Rv0353 and hrcA|Rv2374c (see citation below). |
Mutant | non essential gene by Himar1-based transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 4094660 | 4094914 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3654c|Rv3654c VVARHRAQAAADLASLAAAARLPSGLAAACARATLVARAMRVEHAQCRVVDLDVVVTVEVAVAFAGVATATARAGPAKVPTTPG
Bibliography
- Stewart GR et al. [2002]. Dissection of the heat-shock response in Mycobacterium tuberculosis using mutants and microarrays. Transcriptome Mutant Regulation
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant