Gene Rv3672c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv3672c, (MTV025.020c), len: 273 aa. Conserved hypothetical protein, equivalent to Q9CB94|ML2299 hypothetical protein from Mycobacterium leprae (266 aa) FASTA scores: opt: 1358, E(): 5.2e-75, (76.4% identity in 267 aa overlap). Also similar to others (generally in C-terminal end) e.g. Q9XA45|SCH17.02c hypothetical 26.5 KDA protein from Streptomyces coelicolor (247 aa) FASTA scores: opt: 524, E(): 1.3e-24, (42.65% identity in 251 aa overlap); Q9AB27|CC0407 mutt/NUDIX family protein from Caulobacter crescentus (216 aa), FASTA scores: opt: 285, E(): 3.2e-10, (36.2% identity in 174 aa overlap); BAB49788|MLL2727|Q98HS8 hypothetical protein from Rhizobium loti (Mesorhizobium loti) (204 aa), FASTA scores: opt: 278, E(): 8.1e-10, (31.45% identity in 151 aa overlap); P43337|YEAB_ECOLI|B1813 hypothetical 21.4 KDA protein from Escherichia coli strain K12 (192 aa) FASTA scores: opt: 252, E(): 2.9e-08, (35.9% identity in 170 aa overlap); etc. Contains PS01293 Uncharacterized protein family UPF0036 signature, LLT. |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4113521 | 4114342 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3672c|Rv3672c
MSAGGTPLQAGATPTGSRGTVALRPDAGPSWLRPLVDNVGQIPDAYRRRLPADVLAMVTAAGAVSAMTSSRRDHREAAVLVLFSGPEAGPGDGGVPDDADLLLTVRASTLRHHAGQAAFPGGVVDPADDGPVATALREANEETGIDPSRLHPLATMERTFIAPSRFHVVPVLAYSPDPGPVAVVNEAETAIVARVPVRAFINPANRLMVYRRPHTRRWAGPAFLLNQMLVWGFTGQVISAVLDVAGWAQPWDTGDIRELDAAMVLIDDESDPR
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
