Gene Rv3698
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved protein |
| Comments | Rv3698, (MTV025.046), len: 509 aa. Conserved protein, highly similar to Q9AK89|SC10A9.15c conserved hypothetical protein from Streptomyces coelicolor (505 aa), FASTA scores: opt: 1720, E(): 9e-103, (53.65% identity in 494 aa overlap). N-terminal end highly similar to CAC42136|SCBAC25F8.01 conserved hypothetical protein (fragment) from Streptomyces coelicolor (291 aa), FASTA scores: opt: 1078, E(): 8.7e-62, (52.6% identity in 291 aa overlap); and C-terminus highly similar to CAC44687|SCBAC17A6.42c (235 aa), FASTA scores: opt: 911, E(): 3.8e-51, (57.25% identity in 234 aa overlap). |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4140493 | 4142022 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3698|Rv3698
MRTISPFLRCRHETCCISNVGEEVTRTTYSREHQREYRRKVRLCLDVFETMLAQTRFEADRPLTGMEIECNLVDADYQPAMSNRYVLDAIADPAYQTELGAYNIEFNVPPRPLPGRTCLELEDEVRASLNDAETKASCSGAHIVMIGILPTLMPEHLTDGWMSASARYAALNESIFKARGEDIPINIAGPEPLSCHAGSIAPESACTSVQLHLQLAPADFPANWNAAQVLAGPQLALGANSPYFFGHQLWSETRIELFTQSTDARPEELKSRGVRPRVWFGERWITSVLDLFQENIRYFPTLLPEVSDEDPLAELSAGRIPHLSELRLHNGTVYRWNRPVYDVVDGRPHLRLENRVLPAGPTVVDMLANHAFYYGALRGLSEADPPLWTQMNFAAAQANFLAAARYGMDAQLDWPGLGEVTTRELVLGTLLPMAHEGLRRWGVDAEVRDRFLGVIGGRAQTGRNGARWQVATVAALQDGGLTRPAALAEMLRRYCEHMHSNEPVHTWDT
Bibliography
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
