Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown; probably involved in cellular metabolism.
ProductConserved hypothetical protein
CommentsRv3700c, (MTV025.048c), len: 390 aa. Conserved hypothetical protein; could be a transferase or a lyase. Indeed, similar to various enzymes e.g. Q53824|CAC capreomycin acetyltransferase from Streptomyces capreolus (359 aa), FASTA scores: opt: 338, E(): 1.1e-12, (33.35% identity in 363 aa overlap); Q9HXX3|CSD_PSEAE|PA3667 probable cysteine desulfurase from Pseudomonas aeruginosa (401 aa) FASTA scores: opt: 260, E(): 4.8e-08, (30.2% identity in 404 aa overlap); Q9X815|SC6G10.30 putative aminotransferase from Streptomyces coelicolor (460 aa), FASTA scores: opt: 243, E(): 5.4e-07, (29.15% identity in 374 aa overlap); Q9A761|CC1865 aminotransferase class V from Caulobacter crescentus (379 aa), FASTA scores: opt: 234, E(): 1.6e-06, (27.95% identity in 383 aa overlap); O74351|NFS1_SCHPO|SPBC21D10.11c probable cysteine desulfurase from Schizosaccharomyces pombe (Fission yeast) (498 aa), FASTA scores: opt: 232, E(): 2.5e-06, (29.1% identity in 285 aa overlap); Q9RME8|NIFS NIFS protein (cysteine desulfurase, tRNA splicing protein) from Zymomonas mobilis (370 aa), FASTA scores: opt: 230, E(): 2.6e-06, (32.85% identity in 201 aa overlap); etc. Contains PS00626 Regulator of chromosome condensation (RCC1) signature 2.
Functional categoryIntermediary metabolism and respiration
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS41427484143920-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3700c|Rv3700c
MRRSGANSPAGDSLADRWRAARPPVAGLHLDSAACSRQSFAALDAAAQHARHEAEVGGYVAAEAAAAVLDAGRAAVAALSGLPDAEVVFTTGSLHALDLLLGSWPGENRTLACLPGEYGPNLAVMAAHGFDVRPLPTLQDGRVALDDAAFMLADDPPDLVHLTVVASHRGVAQPLAMVAQLCTELKLPLVVDAAQGLGHVDCAVGADVTYASSRKWIAGPRGVGVLAVRPELMERLRARLPAPDWMPPLTVAQQLGFGEANVAARVGFSVALGEHLACGPQAIRARLAELGDIARTVLADVSGWRVVEAVDEPSAITTLAPIDGADPAAVRAWLLSQRRIVTTYAGVERAPLELPAPVLRISPHVDNTADDLDAFAEALVAATAATSGER