Gene Rv3700c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown; probably involved in cellular metabolism. |
| Product | Conserved hypothetical protein |
| Comments | Rv3700c, (MTV025.048c), len: 390 aa. Conserved hypothetical protein; could be a transferase or a lyase. Indeed, similar to various enzymes e.g. Q53824|CAC capreomycin acetyltransferase from Streptomyces capreolus (359 aa), FASTA scores: opt: 338, E(): 1.1e-12, (33.35% identity in 363 aa overlap); Q9HXX3|CSD_PSEAE|PA3667 probable cysteine desulfurase from Pseudomonas aeruginosa (401 aa) FASTA scores: opt: 260, E(): 4.8e-08, (30.2% identity in 404 aa overlap); Q9X815|SC6G10.30 putative aminotransferase from Streptomyces coelicolor (460 aa), FASTA scores: opt: 243, E(): 5.4e-07, (29.15% identity in 374 aa overlap); Q9A761|CC1865 aminotransferase class V from Caulobacter crescentus (379 aa), FASTA scores: opt: 234, E(): 1.6e-06, (27.95% identity in 383 aa overlap); O74351|NFS1_SCHPO|SPBC21D10.11c probable cysteine desulfurase from Schizosaccharomyces pombe (Fission yeast) (498 aa), FASTA scores: opt: 232, E(): 2.5e-06, (29.1% identity in 285 aa overlap); Q9RME8|NIFS NIFS protein (cysteine desulfurase, tRNA splicing protein) from Zymomonas mobilis (370 aa), FASTA scores: opt: 230, E(): 2.6e-06, (32.85% identity in 201 aa overlap); etc. Contains PS00626 Regulator of chromosome condensation (RCC1) signature 2. |
| Functional category | Intermediary metabolism and respiration |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4142748 | 4143920 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3700c|Rv3700c
MRRSGANSPAGDSLADRWRAARPPVAGLHLDSAACSRQSFAALDAAAQHARHEAEVGGYVAAEAAAAVLDAGRAAVAALSGLPDAEVVFTTGSLHALDLLLGSWPGENRTLACLPGEYGPNLAVMAAHGFDVRPLPTLQDGRVALDDAAFMLADDPPDLVHLTVVASHRGVAQPLAMVAQLCTELKLPLVVDAAQGLGHVDCAVGADVTYASSRKWIAGPRGVGVLAVRPELMERLRARLPAPDWMPPLTVAQQLGFGEANVAARVGFSVALGEHLACGPQAIRARLAELGDIARTVLADVSGWRVVEAVDEPSAITTLAPIDGADPAAVRAWLLSQRRIVTTYAGVERAPLELPAPVLRISPHVDNTADDLDAFAEALVAATAATSGER
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
