Gene Rv3702c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv3702c, (MTV025.050c), len: 233 aa. Conserved hypothetical protein, highly similar to other hypothetical proteins Q9RCZ9|SCM1.45 from Streptomyces coelicolor (271 aa), FASTA scores: opt: 383, E(): 2.3e-17, (44.85% identity in 252 aa overlap); and P54004|Y199_SYNY3|SLR0199 from Synechocystis sp. strain PCC 6803 (304 aa), FASTA scores: opt: 292, E(): 1.7e-11, (30.05% identity in 263 aa overlap); and similar to others e.g. Q9KMU4|VCA0225 from Vibrio cholerae (254 aa), FASTA scores: opt: 260, E(): 1.6e-09, (29.8% identity in 245 aa overlap). Equivalent to AAK48172 from Mycobacterium tuberculosis strain CDC1551 (194 aa) but longer 39 aa. |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4144913 | 4145614 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3702c|Rv3702c
MCRHLGWLGAQVAVSSLVLDPPQGLRVQSYAPRRQKHGLMNADGWGVGFFDGAIPRRWRSPAPLWGDTSFHSVAPALRSHCILAAVRSATVGMPIEVSATPPFTDGHWLLAHNGVVDRAVLPAGPAAESVCDSAILAATIFAHGLDALGDTIVKVGAADPNARLNILAANGSRLIATTWGDTLSILRRADGVVLASEPYDDDSGWGDVPDRHLVEVTQKGVTLTALDRAKGPR
Bibliography
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
