Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv3702c, (MTV025.050c), len: 233 aa. Conserved hypothetical protein, highly similar to other hypothetical proteins Q9RCZ9|SCM1.45 from Streptomyces coelicolor (271 aa), FASTA scores: opt: 383, E(): 2.3e-17, (44.85% identity in 252 aa overlap); and P54004|Y199_SYNY3|SLR0199 from Synechocystis sp. strain PCC 6803 (304 aa), FASTA scores: opt: 292, E(): 1.7e-11, (30.05% identity in 263 aa overlap); and similar to others e.g. Q9KMU4|VCA0225 from Vibrio cholerae (254 aa), FASTA scores: opt: 260, E(): 1.6e-09, (29.8% identity in 245 aa overlap). Equivalent to AAK48172 from Mycobacterium tuberculosis strain CDC1551 (194 aa) but longer 39 aa.
Functional categoryConserved hypotheticals
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS41449134145614-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3702c|Rv3702c
MCRHLGWLGAQVAVSSLVLDPPQGLRVQSYAPRRQKHGLMNADGWGVGFFDGAIPRRWRSPAPLWGDTSFHSVAPALRSHCILAAVRSATVGMPIEVSATPPFTDGHWLLAHNGVVDRAVLPAGPAAESVCDSAILAATIFAHGLDALGDTIVKVGAADPNARLNILAANGSRLIATTWGDTLSILRRADGVVLASEPYDDDSGWGDVPDRHLVEVTQKGVTLTALDRAKGPR