Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv3707c, (MTV025.055c), len: 336 aa. Equivalent to Q9CB79|ML2321 hypothetical protein from Mycobacterium leprae (336 aa), FASTA scores: opt: 1948, E(): 6.7e-110, (81.95% identity in 332 aa overlap); and P41402|YASD_MYCSM hypothetical 35.9 KDA protein in the aspartokinase gene cluster from Mycobacterium smegmatis (333 aa), FASTA scores: opt: 1731, E(): 7.4e-97, (70.85% identity in 333 aa overlap).
Functional categoryConserved hypotheticals
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS41500304151040-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3707c|Rv3707c
VLRIGPTAGTGTPTGDYGIGATDLCEFVEFPSQLLQVCGDSFAGQGVGFGGWYAPVALHVDTESIDDPAGVRYTGVTGVGTPLLADPTPPGDSQLPAGVVQINRRNYLMVTTTKDLQPQNSRLVRAEAARGGWQTVSGSRRNAAYQDGRQTQISGYYDPVPTPDSPTGWVYIVADSFTRGEPAVLYRATPESFTDRSRWQGWAGGPDGGWNKPPTPLWPDQLGEMSIRQIDGQTVLSYFNASTGNMEVRVAHHPTSLGAAPVTTVVRHDEWPEPAESLPPPYDNRLAQPYGGYISPGSTIDELRIFVSQWDTRARQNGPYRVIQFAVNPFKPWSDP