Gene Rv3726
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown; probably involved in cellular metabolism. |
| Product | Possible dehydrogenase |
| Comments | Rv3726, (MTV025.074), len: 397 aa. Possible dehydrogenase, similar to many e.g. O34788|YDJL dehydrogenase from Bacillus subtilis (346 aa) FASTA scores: opt: 401, E(): 3.4e-17, (29.6% identity in 395 aa overlap); Q59696|ADH 2,3-butanediol dehydrogenase from seudomonas putida (362 aa), FASTA scores: opt: 326, E(): 1.3e-12, (29.45% identity in 387 aa overlap); AAG59541|YJJN putative oxidoreductase from Escherichia coli strain EDL933 (345 aa), FASTA scores: opt: 325, E(): 1.5e-12, (30.85% identity in 256 aa overlap); Q9HWM8|PA4153 2,3-butanediol dehydrogenase from Pseudomonas aeruginosa (363 aa), FASTA scores: opt: 324, E(): 1.8e-12, (30.5% identity in 387 aa overlap); etc. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4171421 | 4172614 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3726|Rv3726
MKAVTCTNAKLEVVDRPSPAPAKGQLLLDVLRCGICGSDLHARLHCDELADVMAESGYHAFMRSNQQVVFGHEFCGEVVDYGPGTRRTPRRGTPVVAMPLLRRGNKEVHGIGLSTMAPGAYAERLVVEQSLTFPVPNGLAPEIAALTEPMAVGWHAVRRGEVGKGDVAIVIGCGPIGLAVICMLKSRGVHTVIASDFSPGRRALATACGADSVVDPVQDSPYAVAAGLGQGNRHLQSILDAFDLAVGTVERLQRLRLPWWHLWRAAEAAGAATPKRPVIFECVGVPGIIDGIIASAPLFSRVVVVGVCMGSDHIRPAMAINKEINLRFVLGYTPLEFRDTLHMLADGKVNAAPLITGTVGLPGVAAAFDALGDPEAHAKIMIDPKSNAASPQPFRVE
Bibliography
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Xiong Y, Chalmers MJ, Gao FP, Cross TA and Marshall AG [2005]. Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. Proteomics
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
