Gene Rv3741c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown; probably involved in cellular metabolism. |
| Product | Possible oxidoreductase |
| Comments | Rv3741c, (MTV025.089c), len: 224 aa. Possible oxidoreductase, probably combines with product of upstream ORF MTV025.090c to form a functional monooxygenase, highly similar to C-terminal end of various oxidoreductases e.g. Q9APW3 aromatic-ring hyroxylase from Pseudomonas aeruginosa (508 aa), FASTA scores: opt: 549, E(): 5.9e-28, (56.1% identity in 155 aa overlap); Q9A588|CC2569 monooxygenase (flavin-binding family) from Caulobacter crescentus (498 aa), FASTA scores: opt: 487, E(): 5.6e-24, (39.55% identity in 225 aa overlap); Q9RZT0|DRB0033 arylesterase/monoxygenase from Deinococcus radiodurans (833 aa), FASTA scores: opt: 460, E(): 4.7e-22, (38.5% identity in 226 aa overlap); etc. Also similar to C-terminal end of Mycobacterium tuberculosis proteins (generally monooxygenases) e.g. P96223|Rv3854c|MTCY01A6.14 hypothetical 55.3 KDA protein (489 aa), FASTA scores: opt: 542, E(): 1.6e-27, (50.0% identity in 162 aa overlap); O53762|Rv0565c|MTV039.03c putative monoxygenase (486 aa), FASTA scores: opt: 462, E(): 2.2e-22, (37.15% identity in 226 aa overlap); O53300|Rv3083|MTV013.04 monoxygenase (495 aa), FASTA scores: opt: 462, E(): 2.2e-22, (45.65% identity in 173 aa overlap); etc. Note similarity to MTCY01A6.14 and MTV013.04 continue in upstream ORF (MTV025.090c) after a gap of ~100 aa. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified in the cell wall and cell membrane fractions of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4192179 | 4192853 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3741c|Rv3741c
MIGRDRAYAVTRRKDIAKQRLVWRLCQRYPRAARRLIRHLNAKQLAAGYPADEHFKPVYNPWDQRLCAVPDADMFKAIRDGRASVVTEAIDTFTENGIRLQSGRELAADISITATGLNLLAFGGINLSVDGVAVDVAEKVAFKGFLLSDVSNFAGPHGRTRAHHLLSAAARSHADPAAAGRRSPLADLKVLREGPVDDDHLRFTTSASASRLTVKRITRSTPWN
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
