Gene Rv3745c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv3745c, (MTV025.093c), len: 70 aa. Conserved hypothetical protein, highly similar to others e.g. N-terminus of Q9X4E6 hypothetical 13.4 KDA protein from Rhodobacter sphaeroides (Rhodopseudomonas sphaeroides) (124 aa), FASTA scores: opt: 279, E(): 4.4e-14, (59.4% identity in 69 aa overlap); N-terminus of Q9A2A6|CC3660 hypothetical protein from Caulobacter crescentus (172 aa) FASTA scores: opt: 272, E(): 1.9e-13, (63.35% identity in 60 aa overlap); N-terminus of P74345|SLR1628 hypothetical 14.5 KDA protein from Synechocystis sp. strain PCC 6803 (134 aa), FASTA scores: opt: 233, E(): 1.3e-10, (54.85% identity in 62 aa overlap); etc. |
| Functional category | Conserved hypotheticals |
| Mutant | non essential gene by Himar1-based transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4195886 | 4196098 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3745c|Rv3745c
MSDCNVLGGALEQGGTDPLTGFYRDGCCATGPEDLGWHTICAVMTTEFLAHQRSVGNDLSIARPPRWLRP
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
