Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv3748, (MTV025.096), len: 119 aa. Hypothetical protein, highly similar to upstream ORF O69714|Rv3747|MTV025.095 conserved hypothetical protein (127 aa), FASTA scores: opt: 496, E(): 2.5e-28, (64.4% identity in 118 aa overlap).
Functional categoryConserved hypotheticals
ProteomicsTranslational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS41972364197595+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3748|Rv3748
VIVGAFLAEAASVVDNKLNVSGGVLYRFAVDPDRSAQFLLVVLTQAETDDPDRRVDVEVWPPTGDDAHHIEFELPEAAVAAEVGFAIFRIEVNLPVDGRWVLVVTGGAGTISLPLIVTG