Gene Rv3749c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv3749c, (MTV025.097c), len: 169 aa. Hypothetical protein, showing some similarity with O85864 hypothetical 21.4 KDA protein from Sphingomonas aromaticivorans plasmid pNL1 (196 aa), FASTA scores: opt: 148, E(): 0.011, (32.7% identity in 104 aa overlap); Q9LCU6 hypothetical 21.2 KDA protein from Arthrobacter sp. TM1 (192 aa), FASTA scores: opt: 125, E(): 0.35, (31.5% identity in 92 aa overlap); Q9L631|SPCB myo-inositol-2-dehydrogenase from Streptomyces spectabilis (374 aa); Q9WJP8|PRE-S1 PRE-S1 protein (fragment) from Hepatitis B virus (88 aa); etc. Contains PS00092 N-6 Adenine-specific DNA methylases signature. Predicted to be an outer membrane protein (See Song et al., 2008). This region is a possible MT-complex-specific genomic island (See Becq et al., 2007). |
| Functional category | Conserved hypotheticals |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4197628 | 4198137 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3749c|Rv3749c
MPCCGSLTRAPIGLCGRRTSWPRLGEPWSTASTSAPNGLTTAFAFGYNDLIAAMNNHYKDRHVLAAAVRERAEVIVTTNLKHFPDDALKPYQIKALHPDDFLLDQLDLYEEATKAVILGMVDAYIDPPFTPHSLLDALGEQVPQFAAKARRLFPSGSPFGLGVLLPFDQ
Bibliography
- Parish T, Smith DA, Roberts G, Betts J and Stoker NG [2003]. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Regulation
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Becq J, Gutierrez MC, Rosas-Magallanes V, Rauzier J, Gicquel B, Neyrolles O and Deschavanne P [2007]. Contribution of horizontally acquired genomic islands to the evolution of the tubercle bacilli. Sequence
- Song H, Sandie R, Wang Y, Andrade-Navarro MA and Niederweis M [2008]. Identification of outer membrane proteins of Mycobacterium tuberculosis. Localization
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant