Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv3749c, (MTV025.097c), len: 169 aa. Hypothetical protein, showing some similarity with O85864 hypothetical 21.4 KDA protein from Sphingomonas aromaticivorans plasmid pNL1 (196 aa), FASTA scores: opt: 148, E(): 0.011, (32.7% identity in 104 aa overlap); Q9LCU6 hypothetical 21.2 KDA protein from Arthrobacter sp. TM1 (192 aa), FASTA scores: opt: 125, E(): 0.35, (31.5% identity in 92 aa overlap); Q9L631|SPCB myo-inositol-2-dehydrogenase from Streptomyces spectabilis (374 aa); Q9WJP8|PRE-S1 PRE-S1 protein (fragment) from Hepatitis B virus (88 aa); etc. Contains PS00092 N-6 Adenine-specific DNA methylases signature. Predicted to be an outer membrane protein (See Song et al., 2008). This region is a possible MT-complex-specific genomic island (See Becq et al., 2007).
Functional categoryConserved hypotheticals
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS41976284198137-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3749c|Rv3749c
MPCCGSLTRAPIGLCGRRTSWPRLGEPWSTASTSAPNGLTTAFAFGYNDLIAAMNNHYKDRHVLAAAVRERAEVIVTTNLKHFPDDALKPYQIKALHPDDFLLDQLDLYEEATKAVILGMVDAYIDPPFTPHSLLDALGEQVPQFAAKARRLFPSGSPFGLGVLLPFDQ