Gene Rv3761c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown, but possibly involvement in lipid degradation. |
| Product | Possible acyl-CoA dehydrogenase FadE36 |
| Comments | Rv3761c, (MTV025.109c), len: 351 aa. Possible fadE36, acyl-CoA dehydrogenase, similar to many conserved hypothetical proteins and showing some similarity with few acyl-CoA dehydrogenases, e.g. Q9APX7|FADE36 FADE36 protein from Pseudomonas aeruginosa (360 aa), FASTA scores: opt: 147, E(): 0.046, (26.15% identity in 214 aa overlap); part of AAB52261.2|U97002 protein similar to acyl-CoA dehydrogenases and epoxide hydrolases from Caenorhabditis elegans (985 aa), FASTA score: (31.2% identity in 324 aa overlap). C-terminal part is highly similar to Q50095|U1740AK|MLU15183_45 hypothetical protein from Mycobacterium leprae cosmid B174 (122 aa), FASTA scores: opt: 341, E(): 7.3e-15, (57.6% identity in 99 aa overlap). Contains PS00339 Aminoacyl-transfer RNA synthetases class-II signature 2. |
| Functional category | Lipid metabolism |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified by mass spectrometry in whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4205862 | 4206917 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3761c|fadE36
VTSVDRLDGLDLGALDRYLRSLGIGRDGELRGELISGGRSNLTFRVYDDASSWLVRRPPLHGLTPSAHDMAREYRVVAALGDTPVPVARTISLCQDDSVLGAPFQVVEFVAGQVVRRRAELEALGSRSVIEGCVDALIRVLVDLHSIDPKAVGLSDFGKPDGYLERQVRRWGSQWELVRLPDDHRDADISRLHLALQQAIPQQSRTSIVHGDYRIDNTILDTDDPCHVRAVVDWELSTLGDPLSDAALMCVYRDPALDLIVHAQAAWTSPLLPAADELADRYSLVSGQPLGHWEFYMALAYFKLAIIAAGIDYRRRMSEQAEGKDTAAESVPDVVAPLIARGLAEIAKKSG
Bibliography
- Chubb AJ, Woodman ZL, da Silva Tatley FM, Hoffmann HJ, Scholle RR and Ehlers MR [1998]. Identification of Mycobacterium tuberculosis signal sequences that direct the export of a leaderless beta-lactamase gene product in Escherichia coli. Secretion
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
