Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionShown to inhibit gamma interferon regulated HLA-DR protein and mRNA expression in human macrophages
Product19 kDa lipoprotein antigen precursor LpqH
CommentsRv3763, (MTV025.111), len: 159 aa. LpqH, conserved 19 KDa lipoprotein antigen precursor (see citations below), equivalent to P31502|19KD_MYCIT|MI22 19 KDA lipoprotein antigen precursor (MI22 antigen) from Mycobacterium intracellulare (162 aa), FASTA scores: opt: 773, E(): 6.2e-35, 75.95(% identity in 162 aa overlap); P46733|19KD_MYCAV 19 KDA lipoprotein antigen precursor from Mycobacterium avium (161 aa), FASTA scores: opt: 743, E(): 2.5e-33, (72.5% identity in 160 aa overlap); and Q9X7A5|LPQH|ML1966 possible lipoprotein from Mycobacterium leprae FASTA scores: opt: 371, E(): 2.2e-13, (42.6% identity in 162 aa overlap). Possibly attached to the membrane by a lipid anchor. Similar to other mycobacterium 19 KDA antigen. Contains PS00013 Prokaryotic membrane lipoprotein lipid attachment site.
Functional categoryCell wall and cell processes
ProteomicsThe product of this CDS corresponds to spots 19kDa or 3763 identified in short term culture filtrate and cell wall by proteomics at the Statens Serum Institute (Denmark) (see proteomics citations). Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified in the detergent phase of Triton X-114 extracts of M. tuberculosis H37Rv membranes using CEGE and MALDI-TOF-MS (See Sinha et al., 2005). Putative glycoprotein identified by LC/ESI-MS/MS in the culture filtrate of M. tuberculosis H37Rv (See Gonzalez-Zamorano et al., 2009). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011).
TranscriptomicsmRNA identified by microarray analysis and up-regulated after 4h of starvation (see Betts et al., 2002).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Found to be deleted (partially or completely) in one or more clinical isolates (See Tsolaki et al., 2004).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS42090474209526+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3763|lpqH
VKRGLTVAVAGAAILVAGLSGCSSNKSTTGSGETTTAAGTTASPGAASGPKVVIDGKDQNVTGSVVCTTAAGNVNIAIGGAATGIAAVLTDGNPPEVKSVGLGNVNGVTLGYTSGTGQGNASATKDGSHYKITGTATGVDMANPMSPVNKSFEIEVTCS
      
Bibliography