Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in histidine biosynthetic pathway (at the eighth step) [catalytic activity: L-histidinol-phosphate + 2-oxoglutarate = 3-(imidazol-4-YL)-2-oxopropyl phosphate + glutamate].
ProductProbable histidinol-phosphate aminotransferase HisC2 (imidazole acetol-phosphate transaminase) (imidazolylacetolphosphate aminotransferase)
CommentsRv3772, (MTCY13D12.06), len: 353 aa. Probable hisC2, histidinol-phosphate aminotransferase, highly similar to Q9ZBY8|SCD78.11 putative histidinol-phophate aminotransferase from Streptomyces coelicolor (359 aa), FASTA scores: opt: 1165, E(): 7.1e-64, (52.55% identity in 356 aa overlap); and similar to many e.g. Q9EYX2 from Gardnerella vaginalis (317 aa) FASTA scores: opt: 814, E(): 1.7e-42, (45.15% identity in 308 aa overlap); Q9CMI7|HISH_1PM0838|HISH from Pasteurella multocida (365 aa), FASTA scores: opt: 701, E(): 1.5e-35, (35.05% identity in 351 aa overlap); O07131|HIS8_METFL|HISC|HISH from Methylobacillus flagellatum (368 aa), FASTA scores: opt: 645, E(): 4e-32, (34.5% identity in 345 aa overlap); etc. Contains PS00599 Aminotransferases class-II pyridoxal-phosphate attachment site. Belongs to class-II of pyridoxal-phosphate-dependent aminotransferases. Cofactor: pyridoxal phosphate.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified by proteomics at the Statens Serum Institute (Denmark) (See Rosenkrands et al., 2000). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS42171344218195+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3772|hisC2
VTARLRPELAGLPVYVPGKTVPGAIKLASNETVFGPLPSVRAAIDRATDTVNRYPDNGCVQLKAALARHLGPDFAPEHVAVGCGSVSLCQQLVQVTASVGDEVVFGWRSFELYPPQVRVAGAIPIQVPLTDHTFDLYAMLATVTDRTRLIFVCNPNNPTSTVVGPDALARFVEAVPAHILIAIDEAYVEYIRDGMRPDSLGLVRAHNNVVVLRTFSKAYGLAGLRIGYAIGHPDVITALDKVYVPFTVSSIGQAAAIASLDAADELLARTDTVVAERARVSAELRAAGFTLPPSQANFVWLPLGSRTQDFVEQAADARIVVRPYGTDGVRVTVAAPEENDAFLRFARRWRSDQ