Gene Rv3772
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Involved in histidine biosynthetic pathway (at the eighth step) [catalytic activity: L-histidinol-phosphate + 2-oxoglutarate = 3-(imidazol-4-YL)-2-oxopropyl phosphate + glutamate]. |
| Product | Probable histidinol-phosphate aminotransferase HisC2 (imidazole acetol-phosphate transaminase) (imidazolylacetolphosphate aminotransferase) |
| Comments | Rv3772, (MTCY13D12.06), len: 353 aa. Probable hisC2, histidinol-phosphate aminotransferase, highly similar to Q9ZBY8|SCD78.11 putative histidinol-phophate aminotransferase from Streptomyces coelicolor (359 aa), FASTA scores: opt: 1165, E(): 7.1e-64, (52.55% identity in 356 aa overlap); and similar to many e.g. Q9EYX2 from Gardnerella vaginalis (317 aa) FASTA scores: opt: 814, E(): 1.7e-42, (45.15% identity in 308 aa overlap); Q9CMI7|HISH_1PM0838|HISH from Pasteurella multocida (365 aa), FASTA scores: opt: 701, E(): 1.5e-35, (35.05% identity in 351 aa overlap); O07131|HIS8_METFL|HISC|HISH from Methylobacillus flagellatum (368 aa), FASTA scores: opt: 645, E(): 4e-32, (34.5% identity in 345 aa overlap); etc. Contains PS00599 Aminotransferases class-II pyridoxal-phosphate attachment site. Belongs to class-II of pyridoxal-phosphate-dependent aminotransferases. Cofactor: pyridoxal phosphate. |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified by proteomics at the Statens Serum Institute (Denmark) (See Rosenkrands et al., 2000). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4217134 | 4218195 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3772|hisC2
VTARLRPELAGLPVYVPGKTVPGAIKLASNETVFGPLPSVRAAIDRATDTVNRYPDNGCVQLKAALARHLGPDFAPEHVAVGCGSVSLCQQLVQVTASVGDEVVFGWRSFELYPPQVRVAGAIPIQVPLTDHTFDLYAMLATVTDRTRLIFVCNPNNPTSTVVGPDALARFVEAVPAHILIAIDEAYVEYIRDGMRPDSLGLVRAHNNVVVLRTFSKAYGLAGLRIGYAIGHPDVITALDKVYVPFTVSSIGQAAAIASLDAADELLARTDTVVAERARVSAELRAAGFTLPPSQANFVWLPLGSRTQDFVEQAADARIVVRPYGTDGVRVTVAAPEENDAFLRFARRWRSDQ
Bibliography
- Rosenkrands I et al. [2000]. Towards the proteome of Mycobacterium tuberculosis. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- MÃ¥len H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant