Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown
ProductConserved hypothetical protein
CommentsRv3776, (MTCY13D12.10), len: 519 aa. Conserved hypothetical protein, highly similar to Q10709|YL00_MYCTU|Rv2100|MTCY49.40 hypothetical 58.9 KDA protein from Mycobacterium tuberculosis (550 aa) FASTA scores: opt: 1646, E(): 1.2e-83, (77.85% identity in 510 aa overlap) (homology from potential start at 7744); and similar to other proteins from Mycobacterium tuberculosis (strains H37Rv and CDC1551) e.g. O33266|Rv0336|MTCY279.03 (503 aa) FASTA scores: opt: 682, E(): 2.2e-30, (41.65% identity in 497 aa overlap).
Functional categoryConserved hypotheticals
ProteomicsIdentified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005).
TranscriptomicsmRNA identified by Microarray analysis (see Davis et al., 2002).
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS42210894222648+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3776|Rv3776
MFEISLSDPVELRDADDAALLAAIEDCARAEVAAGARRLSAIAELTSRRTGNDQRADWACDGWDCAAAEVAAALTVSHRKASGQMHLSLTLNRLPQVAALFLAGQLSARLVSIIAWRTYLVRDPEALSLLDAALAKHATAWGPLSAPKLEKAIDSWIDRYDPAALRRTRISARSRDLCIGDPDEDAGTAALWGRLFATDAAMLDKRLTQLAHGVCDDDPRTIAQRRADALGALAAGADRLTCGCGNSDCPSSAGNHRQATGVVIHVVADAAALGAAPDPRLSGPEPALAPEAPATPAVKPPAALISGGGVVPAPLLAELIRGGAALSRMRHPGDLRSEPHYRPSAKLAEFVRIRDMTCRFPGCDQPTEFCDIDHTLPYPLGPTHPSNLKCLCRKHHLLKTFWTGWRDVQLPDGTIIWTAPNGHTYTTHPDSRIFLPSWHTTTAALPPAPSPPAIGPTHTLLMPRRRRTRAAELAHRIKRERAHVTQRNKPPPSGGDTAVAEGFEPPDGVSRLSLSRRVH