Gene Rv3776
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv3776, (MTCY13D12.10), len: 519 aa. Conserved hypothetical protein, highly similar to Q10709|YL00_MYCTU|Rv2100|MTCY49.40 hypothetical 58.9 KDA protein from Mycobacterium tuberculosis (550 aa) FASTA scores: opt: 1646, E(): 1.2e-83, (77.85% identity in 510 aa overlap) (homology from potential start at 7744); and similar to other proteins from Mycobacterium tuberculosis (strains H37Rv and CDC1551) e.g. O33266|Rv0336|MTCY279.03 (503 aa) FASTA scores: opt: 682, E(): 2.2e-30, (41.65% identity in 497 aa overlap). |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Transcriptomics | mRNA identified by Microarray analysis (see Davis et al., 2002). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4221089 | 4222648 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3776|Rv3776
MFEISLSDPVELRDADDAALLAAIEDCARAEVAAGARRLSAIAELTSRRTGNDQRADWACDGWDCAAAEVAAALTVSHRKASGQMHLSLTLNRLPQVAALFLAGQLSARLVSIIAWRTYLVRDPEALSLLDAALAKHATAWGPLSAPKLEKAIDSWIDRYDPAALRRTRISARSRDLCIGDPDEDAGTAALWGRLFATDAAMLDKRLTQLAHGVCDDDPRTIAQRRADALGALAAGADRLTCGCGNSDCPSSAGNHRQATGVVIHVVADAAALGAAPDPRLSGPEPALAPEAPATPAVKPPAALISGGGVVPAPLLAELIRGGAALSRMRHPGDLRSEPHYRPSAKLAEFVRIRDMTCRFPGCDQPTEFCDIDHTLPYPLGPTHPSNLKCLCRKHHLLKTFWTGWRDVQLPDGTIIWTAPNGHTYTTHPDSRIFLPSWHTTTAALPPAPSPPAIGPTHTLLMPRRRRTRAAELAHRIKRERAHVTQRNKPPPSGGDTAVAEGFEPPDGVSRLSLSRRVH
Bibliography
- Davis EO et al. [2002]. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. Sequence Regulation Transcriptome
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant