Gene Rv3786c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Unknown protein |
| Comments | Rv3786c, (MTCY13D12.20), len: 407 aa. Unknown protein. Segment between aa 265-300 (approximately) is highly similar to part of O03937|RORF1608 minor capsid protein from Bacteriophage phig1e (1608 aa), FASTA scores: opt: 242, E(): 8.4e-07, (26.85% identity in 272 aa overlap); Q9ETT9|ORF36 putative peptidase from Corynebacterium equii (Rhodococcus equi) plasmid pREAT701 (p33701) and Plasmid virulence (546 aa), FASTA scores: opt: 231, E(): 1.6e-06, (34.15% identity in 167 aa overlap); O69910|SC2E1.40c hypothetical 22.8 KDA protein. from Streptomyces coelicolor (226 aa) FASTA scores: opt: 218, E(): 4.6e-06, (34.15% identity in 164 aa overlap); and others. |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified in the cell wall and cell membrane fractions of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in the culture filtrate and whole cell lysates of M. tuberculosis H37Rv but not the membrane protein fraction (See de Souza et al., 2011). |
| Transcriptomics | mRNA identified by DNA microarray analysis and possibly down-regulated by hrcA|Rv2374c (see citation below). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv and CDC1551 strains (see Sassetti et al., 2003 and Lamichhane et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4232374 | 4233597 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3786c|Rv3786c
MRILAMTRAHNAGRTLAATLDSLAVFSDDIYVIDDRSTDDTAEILANHPAVTNVVRARPDLPPTPWLIPESAGLELLYRMADFCRPDWVMMVDADWLVETDIDLRAVLARTPDDIVALMCPMVSRWDDPEYPDLIPVMGTAEALRGPLWRWYPGLRAGGKLMHNPHWPANITDHGRIGQLPGVRLVHSGWSTLAERILRVEHYLRLDPDYRFNFGVAYDRSLLFGYALDEVDLLKADYRRRIRGDFDPLEPGGRLPIDREPRAIGRGYGPHAGGFHPGVDFATDPGTPVYAVASGAVSAIDEVDGLVSLTIARCELDVVYVFRPGDEGRLVLGDRIAAGAQLGTIGAQGESADGYLHFEVRTQDGHVNPVRYLANMGLRPWPPPGRLRAVSGSYPPATPCTITAEDR
Bibliography
- Stewart GR et al. [2002]. Dissection of the heat-shock response in Mycobacterium tuberculosis using mutants and microarrays. Transcriptome Regulation
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
