Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionFunction unknown; probably involved in cellular metabolism.
ProductPossible acyltransferase
CommentsRv3814c, (MTCY409.16), len: 261 aa. Possible acyltransferase, highly similar to Q9CDC0|ML0087 putative acyltransferase from Mycobacterium leprae (257 aa), FASTA scores: opt: 753, E(): 7.7e-42, (46.75% identity in 246 aa overlap). Also highly similar to many acyltransferases and hypothetical proteins e.g. Q9K3R3|2SCG4.01 putative acyltransferase from Streptomyces coelicolor (242 aa), FASTA scores: opt: 587, E(): 4.6e-31, (41.95% identity in 243 aa overlap); Q9ZBS1|SC7A1.02 putative acyltransferase from Streptomyces coelicolor (264 aa), FASTA scores: opt: 293, E(): 6.6e-12, (29.2% identity in 267 aa overlap); Q9PNZ5|AAS|CJ0938 putative 2-acylglycerophosphoethanolamine acyltransferase / acyl-acyl carrier protein synthetase from Campylobacter jejuni (1170 aa), FASTA scores: opt: 274, E(): 3.9e-10, (29.1% identity in 219 aa overlap) (similarity only with middle section); Q9EY25 putative acetyl transferase from Xanthomonas oryzae pv. oryzae (249 aa), FASTA scores: opt: 238, E(): 2.4e-08, (29.2% identity in 209 aa overlap); etc. Also highly similar to downstream ORFs O07808|Rv3815c|MTCY409.15 putative acyltransferase from Mycobacterium tuberculosis (251 aa), FASTA scores: opt: 1069, E(): 2.1e-62, (60.4% identity in 245 aa overlap); and O07807|Rv3816c|MTCY409.14 putative acyltransferase from Mycobacterium tuberculosis (259 aa), FASTA scores: opt: 776, E(): 2.5e-43, (50.9% identity in 228 aa overlap). And similar to O53516|Rv2182c|MTV021.15c hypothetical 27.0 KDA protein from Mycobacterium tuberculosis (247 aa), FASTA scores: opt: 239, E(): 2e-08, (30.6% identity in 232 aa overlap).
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005).
MutantNon-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS42792304280015-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3814c|Rv3814c
MAEPFFRMMEILVPSIVAANGNKITFEGLENIPERGGALIALNHTSYVDWVPASIAAHHRRRRLRFMIKAEMQDVRAVNYVIKHAQLIPVDRSVGADAYAVAVQRLRAGELVGLHPEATISRSLELREFKTGAARMALEAQVPIIPMIVWGAHRIWPKDHPKNLFRNKIPIVAAIGSPVRPEGNAEQLNAVLRQAMNAILYRVQEEYPHPKGEHWVPRRLGGGAPTVEESRQLRIAELAKRRQKRGYDGVTSSRRSQVGPH