Gene Rv3814c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown; probably involved in cellular metabolism. |
| Product | Possible acyltransferase |
| Comments | Rv3814c, (MTCY409.16), len: 261 aa. Possible acyltransferase, highly similar to Q9CDC0|ML0087 putative acyltransferase from Mycobacterium leprae (257 aa), FASTA scores: opt: 753, E(): 7.7e-42, (46.75% identity in 246 aa overlap). Also highly similar to many acyltransferases and hypothetical proteins e.g. Q9K3R3|2SCG4.01 putative acyltransferase from Streptomyces coelicolor (242 aa), FASTA scores: opt: 587, E(): 4.6e-31, (41.95% identity in 243 aa overlap); Q9ZBS1|SC7A1.02 putative acyltransferase from Streptomyces coelicolor (264 aa), FASTA scores: opt: 293, E(): 6.6e-12, (29.2% identity in 267 aa overlap); Q9PNZ5|AAS|CJ0938 putative 2-acylglycerophosphoethanolamine acyltransferase / acyl-acyl carrier protein synthetase from Campylobacter jejuni (1170 aa), FASTA scores: opt: 274, E(): 3.9e-10, (29.1% identity in 219 aa overlap) (similarity only with middle section); Q9EY25 putative acetyl transferase from Xanthomonas oryzae pv. oryzae (249 aa), FASTA scores: opt: 238, E(): 2.4e-08, (29.2% identity in 209 aa overlap); etc. Also highly similar to downstream ORFs O07808|Rv3815c|MTCY409.15 putative acyltransferase from Mycobacterium tuberculosis (251 aa), FASTA scores: opt: 1069, E(): 2.1e-62, (60.4% identity in 245 aa overlap); and O07807|Rv3816c|MTCY409.14 putative acyltransferase from Mycobacterium tuberculosis (259 aa), FASTA scores: opt: 776, E(): 2.5e-43, (50.9% identity in 228 aa overlap). And similar to O53516|Rv2182c|MTV021.15c hypothetical 27.0 KDA protein from Mycobacterium tuberculosis (247 aa), FASTA scores: opt: 239, E(): 2e-08, (30.6% identity in 232 aa overlap). |
| Functional category | Intermediary metabolism and respiration |
| Proteomics | Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4279230 | 4280015 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3814c|Rv3814c
MAEPFFRMMEILVPSIVAANGNKITFEGLENIPERGGALIALNHTSYVDWVPASIAAHHRRRRLRFMIKAEMQDVRAVNYVIKHAQLIPVDRSVGADAYAVAVQRLRAGELVGLHPEATISRSLELREFKTGAARMALEAQVPIIPMIVWGAHRIWPKDHPKNLFRNKIPIVAAIGSPVRPEGNAEQLNAVLRQAMNAILYRVQEEYPHPKGEHWVPRRLGGGAPTVEESRQLRIAELAKRRQKRGYDGVTSSRRSQVGPH
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mawuenyega KG et al. [2005]. Mycobacterium tuberculosis functional network analysis by global subcellular protein profiling. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
