Gene Rv3898c
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Function unknown |
| Product | Conserved hypothetical protein |
| Comments | Rv3898c, (MTCY15F10.14), len: 110 aa. Conserved hypothetical protein. Highly similar, but in part, to Q10691|YK83_MYCTU|Rv2083|MT2145|MTCY49.22 hypothetical 30.8 KDA protein from Mycobacterium tuberculosis (314 aa) FASTA scores: opt: 204, E(): 0.00042, (50.6% identity in 81 aa overlap). Similarity suggests it should be in frame with next ORF and that the stop codon could be read through, the sequence appears to be correct. Homology lost upstream at 15138 gatc sequence may suggest discontinuity due to chimerism in cY15F10 or cY49. |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 30 days but not 90 days (See Kruh et al., 2010). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4383653 | 4383985 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3898c|Rv3898c
MTGDQNPAPGPAPGVPIKVTPEILLQVLTTPPASGPAPFPAVPVDLPAPADIANGALFAAGNSGVPGDVESSGLEDLDRRAHAADAVQKFSANEADAAQQFQGVGAQAEA
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
