Gene Rv3912
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Hypothetical alanine rich protein |
| Comments | Rv3912, (MTV008.03), len: 254 aa. Hypothetical unknown ala-rich protein. Cleaved by Rip|Rv2869c, in M. tuberculosis Erdman (See Sklar et al., 2010). |
| Functional category | Conserved hypotheticals |
| Proteomics | Identified by mass spectrometry in M. tuberculosis H37Rv-infected guinea pig lungs at 90 days but not 30 days (See Kruh et al., 2010). |
| Mutant | Non-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4400870 | 4401634 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3912|Rv3912
MSAADKDPDKHSADADPPLTVELLADLQAGLLDDATAARIRSRVRSDPQAQQILRALNRVRRDVAAMGADPAWGPAARPAVVDSISAALRSARPNSSPGAAHAARPHVHPVRMIAGAAGLCAVATAIGVGAVVDAPPPAPSAPTTAQHITVSKPAPVIPLSRPQVLDLLHHTPDYGPPGGPLGDPSRRTSCLSGLGYPASTPVLGAQPIDIDARPAVLLVIPADTPDKLAVFAVAPHCSAADTGLLASTVVPRA
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Kruh NA et al. [2010]. Portrait of a pathogen: the Mycobacterium tuberculosis proteome in vivo. Proteomics
- Sklar JG et al. [2010]. M. tuberculosis intramembrane protease Rip1 controls transcription through three anti-sigma factor substrates. Biochemistry
- Mazandu GK et al. [2012]. Function prediction and analysis of mycobacterium tuberculosis hypothetical proteins. Function
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
