Gene mtbc0_000796
in Mycobacterium tuberculosis MTBC0
General annotation
| Type | CDS |
| Function | Unknown |
| Product | hypothetical protein |
| Comments | - |
| Functional category | Conserved hypotheticals |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 846162 | 846299 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis MTBC0|mtbc0_000796|mtbc0_000796
VVRKHAFHWRYDSTEELELLNQLWQLVSLRLNFFTPTKKALGFRP
Bibliography