Gene mtbc0_001403
in Mycobacterium tuberculosis MTBC0
General annotation
| Type | CDS |
| Function | Unknown |
| Product | F0F1 ATP synthase subunit epsilon |
| Comments | - |
| Functional category | Intermediary metabolism and respiration |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 1476354 | 1476719 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis MTBC0|mtbc0_001403|atpC
MAELNVEIVAVDRNIWSGTAKFLFTRTTVGEIGILPRHIPLVAQLVDDAMVRVEREGEKDLRIAVDGGFLSVTEEGVSILAESAEFESEIDEAAAKQDSESDDPRIAARGRARLRAVGAID
Bibliography