Gene ML0031c
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | Probable secreted proline rich protein (proline rich 28 kda antigen) |
Comments | ML0031c, len: 278 aa. Probable secreted proline rich protein (see citations below), similar to Rv0040c|PR28_MYCTU|P71697 secreted proline rich 28 kDa antigen mtc28 from M. tuberculosis (311 aa), Fasta scores: E(): 0, (65.1% identity in 258 aa overlap). Previously sequenced as O33075|Y14967 (278 aa), Fasta scores: E(): 0, (100.0% identity in 278 aa overlap). C-terminal half is similar to a region of ML0246. Contains a probable N-terminal signal sequence. |
Functional category | Cell wall and cell processes |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 35287 | 36123 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0031c|ML0031c MIQSTQTWRVLAGGLAATAMGVTVFAGGTAAADPSPPAPPPAIPGVLPPASLPPIQSVTAVPGGITTNNRFVATPQAPGPAALGQPPLAVAAPVSESLHDYFKAKNIKLVAQKPHGFKALDITLPVPTRWTQVPDPNVPDAFAVIADRLGNSLYTSNAQLVVYNLVGNFDPKEAITHGFVDTQQLSAWQTTNASKADFDGFPSSIIEGTYRENGMTLNTSRRHVIASSGPDKYLVSLSVTTALSQAVADAPATNAIVNGFRVSSPTVSAPVPPQLGTR
Bibliography
No article yet recorded