Gene MLPM_0031
in Mycobacterium lepromatosis Mx1-22A
General annotation
| Type | CDS |
| Function | Unknown |
| Product | hypothetical protein |
| Comments | - |
| Functional category | Cell wall and cell processes |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 36038 | 36874 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium lepromatosis Mx1-22A|MLPM_0031|MLPM_0031
MIQSTQTWRVLAGGLAATAIGVTVFAGGTAAADPSPPAPPPAIPGVIPPASLPPVQSVTAVPGGITTNNRFVAIPQVPGPAALEPTPPAVAAPVSETLRDYFKAKNIKLMAQKPQGFKALDITLPVPIRWTQVPDPNVPDAFAVIADRLGNSLYTSNAQLVVYNLIGNFDPKEAITHGFADTQQLSAWQTTNASQADFDGFPSSIIEGTYRENDMTLNTSRRHVIASSGPDKYLVSLFVTTALSQAVADAPAIDAIVNGFRVSSPMASAPTLTQLSTR
Bibliography
- Singh P et al. [2015]. Insight into the evolution and origin of leprosy bacilli from the genome sequence of Mycobacterium lepromatosis. Sequence