Gene ML0052c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | ESX CONSERVED COMPONENT ECCCB1 |
| Comments | ML0052c, len: 597 aa. esx conserved component, highly similar to Rv3871|O69736|AL123456 conserved hypothetical protein from M. tuberculosis (591 aa), Fasta scores: E(): 0, (80.9% identity in 596 aa overlap). Show some similarity with the C-terminal part of several proteins while the upstream ML0053 is similar to the corresponding N-terminal part e.g. O86653|AL031231 putative ATP/GTP-binding proteins from Streptomyces coelicolor (1321 aa), Fasta scores: E(): 0, (34.7% identity in 574 aa overlap); Rv3447c|O06264|AL123456 unknown membrane protein from M. tuberculosis (1236 aa), Fasta scores: E(): 0, (35.2% identity in 588 aa overlap); and Rv1784. Related proteins are also found in Bacillus spp. Similar to the C-terminal halves of ML1543 and ML2535. Previously sequenced as O33086|Y14967 (597 aa), Fasta scores: E(): 0, (99.7% identity in 597 aa overlap). Contains 2 Pfam matches to entry PF01580 FtsK_SpoIIIE, FtsK/SpoIIIE family. Contains 2 x PS00017 ATP/GTP-binding site motif A (P-loop). |
| Functional category | Cell wall and cell processes |
| Mutant | Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 63319 | 65112 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0052c|eccCb1
MTAEPEVRALREVVLEQLGTGESLAYKMWLPPLLDPLPLNELIERDSNRHPLHFALGIMDEPRRHRQDIWGVDLSGAGGNIGIGGAPQTGKTTLLQTMVMSAAATHSPRDVQFYCIDLGGGGLIYLENLPHVGGVANRSEPDRINRVIAEAQAVMRQREITFKENRVGSMAAYRQLRTNRSHPVAADPFGDVFLIIDGWSAFTSEFPDLEAAVQDLAAQGLSFGVHTVITTPRWTELRSRVRDYLGTKIEFRLGDVNDTQIDRIARDIPANRPGRAISVEKHHLMMGVPRFDGAHSADDLVDAMTAGVAQIAAKTTEQAPRVRVLPSQVYLQEIDPNPPGPDSDYRTRWTIPVGVRETDLSVAYAHMSSNPHLLIFGNSKSGKTRIVHAIARAICARNSPKQVRFMLADYRSSLLDAVPDSHLLDAGAINRNSASLDEAIRALTTNLKKRLPPADLTTAQVRSRSWWSGFDVVLLVDDWHMIVSAAGSAPPMGPLAPLLPAAPDIGLHILVTCLMSQAYKATMDKFVGSAFGAGAPTIFLSGDKQEFPSSEIKVKRRPPGQAFMVSPEAKEVIQAVYVDPPEVDPPKEVFAVPPASS
Bibliography
- [2009]. Systematic genetic nomenclature for type VII secretion systems. Nomenclature Product