Gene ML0074
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable glycerophosphoryl diester phosphodiesterase GlpQ1 (glycerophosphodiester phosphodiesterase) |
| Comments | ML0074, len: 271 aa. Probable glpQ1, glycerophosphoryl diester phosphodiesterase (EC 3.1.4.46), highly similar to Rv3842c|P96236|AL123456 glpQ1, glycerophosphoryl diester phosphodiesterase from M. tuberculosis (274 aa), Fasta scores: E(): 0, (88.8% identity in 269 aa overlap). Also similar to GLPQ_BACSU|P37965 glpQ, glycerophosphoryl diester phosphodiesterase from Bacillus subtilis (293 aa), Fasta scores: E(): 2.3e-20, (32.0% identity in 250 aa overlap). |
| Functional category | Intermediary metabolism and respiration |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 95132 | 95947 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0074|glpQ1
MMLADEVFAGHPFVVAHRGASAVLPEHTLAAYELALKEGADGVECDVRLTRDGHMVCVHDRRLDRTSTGVGLVSTMTLAQLRALEYGAWHNSWRPDGTHGDTGLLTLDALVSLVLDWHRPVKIFVETKHPVRYGALVESKLLALLHRFGIAAPASADRSRAVVMSFSAAAVWRVRRAAPLLPTVLLGRAGRYLTSSAATAVGATAVGPSLPALKEYPKLVDRAGAQGRAVYCWNVDDYDDIDFCRDIGVAWIATRHPGRTKAWLQNNGRTE
Bibliography
No article yet recorded