Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionGlycerophosphoryl diester phosphodiesterase hydrolyzes deacylated phospholipids to G3P and the corresponding alcohols [catalytic activity: a glycerophosphodiester + H(2)O = an alcohol + SN-glycerol 3-phosphate].
ProductProbable glycerophosphoryl diester phosphodiesterase GlpQ1 (glycerophosphodiester phosphodiesterase)
CommentsRv3842c, (MTCY01A6.27), len: 274 aa. Probable glpQ1, glycerophosphoryl diester phosphodiesterase, equivalent to Q9CDC5|GLPQ|ML0074 putative glycerophosphoryl diester phosphodiesterase from Mycobacterium leprae (271 aa), FASTA scores: opt: 1635, E(): 1.9e-100, (88.85% identity in 269 aa overlap). Also highly similar to others e.g. CAC44700|SCBAC25E3.13c putative phosphodiesterase from Streptomyces coelicolor (275 aa), FASTA scores: opt: 413, E(): 5.7e-20, (48.05% identity in 258 aa overlap); P37965|GLPQ_BACSU glycerophosphoryl diester phosphodiesterase from Bacillus subtilis (293 aa), FASTA scores: opt: 405, E(): 2e-19, (31.3% identity in 249 aa overlap); Q99VC9|GLPQ|SA0820 glycerophosphoryl diester phosphodiesterase from Staphylococcus aureus subsp. aureus N315 (309 aa) FASTA scores: opt: 341, E(): 3.5e-15, (29.3% identity in 273 aa overlap); etc.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011).
TranscriptomicsmRNA identified by DNA microarray analysis (gene induced by hypoxia) (see citation below).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Disruption of this gene provides a growth advantage for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Required for survival in primary murine macrophages, by transposon site hybridization (TraSH) in H37Rv (See Rengarajan et al., 2005). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS43147384315562-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3842c|glpQ1
MTWADEVLAGHPFVVAHRGASAARPEHTLAAYDLALKEGADGVECDVRLTRDGHLVCVHDRRLDRTSTGAGLVSTMTLAQLRELEYGAWHDSWRPDGSHGDTSLLTLDALVSLVLDWHRPVKIFVETKHPVRYGSLVENKLLALLHRFGIAAPASADRSRAVVMSFSAAAVWRIRRAAPLLPTVLLGKTPRYLTSSAATAVGATAVGPSLPALKEYPQLVDRSAAQGRAVYCWNVDEYEDIDFCREVGVAWIGTHHPGRTKAWLEDGRANGTTR