Gene ML0094
in Mycobacterium leprae TN
General annotation
Type | CDS |
Function | Unknown |
Product | Possible conserved transmembrane protein |
Comments | ML0094, len: 192 aa. Possible conserved transmembrane protein, highly similar to Rv3807c|O53584|AL123456) possible transmembrane protein from M. tuberculosis (165 aa), Fasta scores: E(): 0, (72.8% identity in 151 aa overlap); and similar to CAB89062|AL353872 putative integral membrane protein SC5G8.11 from Streptomyces coelicolor (169 aa), Fasta scores: E(): 1.7e-15, (45.1% identity in 153 aa overlap). Also similar to Q8NLQ8 Membrane-associated phospholipid phosphatase from Corynebacterium glutamicum (168 aa), Fasta scores: E(): 1.6e-27, (51.9% identity in 160 aa overlap). Contains hydrophobic, possible membrane-spanning region. Contains Pfam match to entry PF01569 PAP2, PAP2 superfamily. |
Functional category | Cell wall and cell processes |
Coordinates
Type | Start | End | Orientation |
---|---|---|---|
CDS | 117295 | 117873 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0094|ML0094 MPEDKAPTGELAAIAAVQSVLVDRPGVLPTARGMSHFGEHSIGWLAISLLGAILVPCRRRYWLVAGAGVFAAHVAAVLIKRMVRRIRPNHPAVTVNVGTPSPLSFPSAHATSTAAAAILIGRASRLPKGIVAAVLVAPMALSRIVLGVHYPSDVAFGVVLGAAVAGTTARFDSRLSRRWTVQHGLSSGSAVK
Bibliography
No article yet recorded