Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in cell wall mycoloylation. Proteins of the antigen 85 complex are responsible for the high affinity of mycobacteria to fibronectin. Possesses a mycolyltransferase activity required for the biogenesis of trehalose dimycolate (cord factor), a dominant structure necessary for maintaining cell wall integrity.
ProductSecreted MPB51/MPT51 antigen protein FbpD (MPT51/MPB51 antigen 85 complex C) (AG58C) (mycolyl transferase 85C) (fibronectin-binding protein C) (85C)
CommentsML0098, len: 301 aa. Probable fbpD (alternate gene names: mpt51, mpb51, fbpC1), secreted MPB51/MPT51 antigen protein (fibronectin-binding protein C) (mycolyl transferase 85C) (EC 2.3.1.-) (see citations below), similar to Rv3803c|A85C_MYCTU|P17944 fbpD, secreted MPB51/MPT51 antigen protein from M. tuberculosis fbpC (340 aa), Fasta scores: E(): 0, (40.7% identity in 305 aa overlap). Also similar to the B- and C- proteins of the mycobacterial antigen 85 complexes. Similar to N-terminal region of CSP1_CORGL|Q01377 PS1 protein precursor from Corynebacterium glutamicum csp1 (657 aa), Fasta scores: E(): 1.4e-14, (31.5% identity in 248 aa overlap). Previously sequenced as MPB51 precursor, Q48923|D26486 (299 aa), Fasta scores: E(): 0, (77.5% identity in 302 aa overlap). Also similar to ML0097, ML2028 and ML2655 from M. leprae. Contains probable N-terminal signal sequence. Contains Pfam match to entry PF00756 Esterase, Putative esterase.
Functional categoryLipid metabolism
Coordinates
TypeStartEndOrientation
CDS122310123215+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium leprae TN|ML0098|fbpD
VRGLSAVVRVLCVAALAVGVFAAAVLLAGTAGNAKAAGYESLMVPSNAMGRDIPVAFMAGGPHAVYLLDAFNAALDVSNWVTAGNAMTTLGGRGISVVAPAGGAYSMYTNWENDGSKQWDTFLSSELPDWLATKRGLAPDGHAAVGASQGGYAALALAAFHPDRFGFAGSLSGFVYPSSTNYNGAILAGLQQFGGIDGNGMWGAPQLGRWKWHDPYVHASLLAQNNTRVWVYSPMTMGGDIDAMIGQAVASMGSSREFYQQYRSVGGHNGHFDFSGGGDNGWGAWAPQLAAMSGDIVGAIR
      
Bibliography
No article yet recorded