Gene ML0098 (mpt51, mpb51, fbpC1)
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Involved in cell wall mycoloylation. Proteins of the antigen 85 complex are responsible for the high affinity of mycobacteria to fibronectin. Possesses a mycolyltransferase activity required for the biogenesis of trehalose dimycolate (cord factor), a dominant structure necessary for maintaining cell wall integrity. |
| Product | Secreted MPB51/MPT51 antigen protein FbpD (MPT51/MPB51 antigen 85 complex C) (AG58C) (mycolyl transferase 85C) (fibronectin-binding protein C) (85C) |
| Comments | ML0098, len: 301 aa. Probable fbpD (alternate gene names: mpt51, mpb51, fbpC1), secreted MPB51/MPT51 antigen protein (fibronectin-binding protein C) (mycolyl transferase 85C) (EC 2.3.1.-) (see citations below), similar to Rv3803c|A85C_MYCTU|P17944 fbpD, secreted MPB51/MPT51 antigen protein from M. tuberculosis fbpC (340 aa), Fasta scores: E(): 0, (40.7% identity in 305 aa overlap). Also similar to the B- and C- proteins of the mycobacterial antigen 85 complexes. Similar to N-terminal region of CSP1_CORGL|Q01377 PS1 protein precursor from Corynebacterium glutamicum csp1 (657 aa), Fasta scores: E(): 1.4e-14, (31.5% identity in 248 aa overlap). Previously sequenced as MPB51 precursor, Q48923|D26486 (299 aa), Fasta scores: E(): 0, (77.5% identity in 302 aa overlap). Also similar to ML0097, ML2028 and ML2655 from M. leprae. Contains probable N-terminal signal sequence. Contains Pfam match to entry PF00756 Esterase, Putative esterase. |
| Functional category | Lipid metabolism |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 122310 | 123215 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0098|fbpD
VRGLSAVVRVLCVAALAVGVFAAAVLLAGTAGNAKAAGYESLMVPSNAMGRDIPVAFMAGGPHAVYLLDAFNAALDVSNWVTAGNAMTTLGGRGISVVAPAGGAYSMYTNWENDGSKQWDTFLSSELPDWLATKRGLAPDGHAAVGASQGGYAALALAAFHPDRFGFAGSLSGFVYPSSTNYNGAILAGLQQFGGIDGNGMWGAPQLGRWKWHDPYVHASLLAQNNTRVWVYSPMTMGGDIDAMIGQAVASMGSSREFYQQYRSVGGHNGHFDFSGGGDNGWGAWAPQLAAMSGDIVGAIR
Bibliography
No article yet recorded