Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in cell wall mycoloylation. Proteins of the antigen 85 complex are responsible for the high affinity of mycobacteria to fibronectin. Possesses a mycolyltransferase activity required for the biogenesis of trehalose dimycolate (cord factor), a dominant structure necessary for maintaining cell wall integrity.
ProductSecreted MPT51/MPB51 antigen protein FbpD (MPT51/MPB51 antigen 85 complex C) (AG58C) (mycolyl transferase 85C) (fibronectin-binding protein C) (85C)
CommentsRv3803c, (MT3910, MTV026.08c), len: 299 aa. FbpD (alternate gene names: mpt51, mpb51, fbpC1), secreted MPB51/MPT51 antigen protein (fibronectin-binding protein C) (mycolyl transferase 85C) (see citations below), identical to Q48923|MPT51|MPB51 antigen precursor from Mycobacterium bovis (299 aa), FASTA scores: opt: 2093, E(): 1.5e-112, (100.0% identity in 299 aa overlap) (see Ohara et al., 1995); and highly similar to other Mycobacterial antigen precursors e.g. Q05868|MPT5_MYCLE|MPT51|ML0098 MPT51 antigen precursor from Mycobacterium leprae (301 aa), FASTA scores: opt: 1624, E(): 9.8e-86, (77.8% identity in 302 aa overlap); O52972|A85C_MYCAV|FBPC antigen 85-C precursor (fibronectin-binding protein C) from Mycobacterium avium (352 aa), FASTA scores: opt: 753, E(): 6.6e-36, (41.5% identity in 315 aa overlap); P21160|A85B_MYCKA antigen 85-B precursor (fibronectin-binding protein B) from Mycobacterium kansasii (325 aa), FASTA scores: opt: 574, E(): 1.1e-25, (37.55% identity in 309 aa overlap); P12942|A85B_MYCBO antigen 85-B precursor from Mycobacterium bovis (323 aa), FASTA scores: opt: 572, E(): 1.4e-25, (39.85% identity in 291 aa overlap); etc. Also similar to P31953|A85C_MYCTU|FBPC|MPT45|Rv0129c|MTCI5.03c|FBPC2 secreted antigen 85-C (mycolyl transferase 85C) (fibronectin-binding protein C) from Mycobacterium tuberculosis (340 aa), FASTA scores: opt: 751, E(): 8.4e-36, (40.65% identity in 310 aa overlap); P17944|A85A_MYCTU|FBPA|MPT44|Rv3804c|MT3911|MTV026.09c secreted antigen 85-a (mycolyl transferase 85A) (fibronectin-binding protein A) from Mycobacterium tuberculosis (338 aa), FASTA scores: opt: 592, E(): 1e-26, (39.05% identity in 302 aa overlap); etc. Contains PS00178 Aminoacyl-transfer RNA synthetases class-I signature. Note that the secreted protein MPB51 is one of the major proteins in the culture filtrate of Mycobacterium bovis BCG. Note that overexpression in an FbpC-deficient M. tuberculosis clinical isolate has no effect on the amount of cell wall-linked mycolates (See Puech et al., 2002).
Functional categoryLipid metabolism
ProteomicsCorresponds to spot 3_250 identified in culture supernatant by proteomics at the Max Planck Institute for Infection Biology, Berlin, Germany, and spot 3803c identified in short term culture filtrate by proteomics at the Statens Serum Institute (Denmark) (see proteomics citations). Identified in the culture supernatant of M. tuberculosis H37Rv using mass spectrometry and Edman degradation (See Mattow et al., 2003). Predicted secreted protein - identified in culture filtrates of M. tuberculosis H37Rv; signal peptide predicted and cleavable signal sequence confirmed experimentally (See Malen et al., 2007). Identified in the culture filtrate of M. tuberculosis H37Rv using LC-MS/MS; antigen recognized by serum pool from tuberculosis patients (See Malen et al., 2008). Identified by mass spectrometry in the culture filtrate and whole cell lysates of M. tuberculosis H37Rv but not the membrane protein fraction (See de Souza et al., 2011).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS42645634265462-
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3803c|fbpD
MKGRSALLRALWIAALSFGLGGVAVAAEPTAKAAPYENLMVPSPSMGRDIPVAFLAGGPHAVYLLDAFNAGPDVSNWVTAGNAMNTLAGKGISVVAPAGGAYSMYTNWEQDGSKQWDTFLSAELPDWLAANRGLAPGGHAAVGAAQGGYGAMALAAFHPDRFGFAGSMSGFLYPSNTTTNGAIAAGMQQFGGVDTNGMWGAPQLGRWKWHDPWVHASLLAQNNTRVWVWSPTNPGASDPAAMIGQAAEAMGNSRMFYNQYRSVGGHNGHFDFPASGDNGWGSWAPQLGAMSGDIVGAIR
      
Bibliography