Gene ML0108c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable short-chain type dehydrogenase/reductase |
| Comments | ML0108c, len: 254 aa. Probable short-chain dehydrogenase/reductase (EC 1.-.-.-), highly similar to Rv3791|Y1J1_MYCTU|P72057 short-chain dehydrogenase/reductase from M. tuberculosis (254 aa), Fasta scores: E(): 0, (89.0% identity in 254 aa overlap); and to other Mycobacterial putative oxidoreductases. Also similar to Q9KZA5 putative short-chain dehydrogenase from Streptomyces coelicolor A3(2) (256 aa), Fasta scores: E(): 3.2e-41, (44.8% identity in 254 aa overlap). Shows weaker similarity to PHBB_ALCEU|P14697 phbB, acetoacetyl-CoA reductase from Alcaligenes eutrophus (246 aa), Fasta scores: E(): 3e-09, (28.3% identity in 191 aa overlap). Also shows weak similarity to ML0429 and to the C-terminal half of ML2565 from M. leprae. Contains Pfam match to entry PF00106 adh_short, short chain dehydrogenase. Contains PS00061 Short-chain dehydrogenases/reductases family signature. Belongs to the short-chain dehydrogenase/reductase (SDR) family. |
| Functional category | Intermediary metabolism and respiration, Lipid metabolism |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 149361 | 150125 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0108c|ML0108c
MVLDAVGHPQTVLLLGGTSEIGLAICKRYLRNAPARIVLAAMPDDPNREDAVAQMTAVGARSVELIDFEALDTDSHPRMIEQAFTGGDVDVAIVAFGLLGDAEELWQNQSKAVQIAEINYTAAVSVGVLLGEKMRAQGFGQIIVMSSAAGERVRRSNFVYGSTKAGLDGFYLGLSEALHEYGVHVLVIRPGQVRTRMSAHVKEAPLTVNKEYVADLAVTAAAKGKELVWAPATFRYVMMVLRHIPRSIFRKLPI
Bibliography
No article yet recorded