Gene Rv3791
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Together with DPRE2|Rv3791, catalyzes epimerization of decaprenylphosphoryl ribose (DPR) to decaprenylphosphoryl arabinose (DPA) in arabinan synthesis |
| Product | Decaprenylphosphoryl-D-2-keto erythro pentose reductase |
| Comments | Rv3791, (MTCY13D12.25), len: 254 aa. DprE2, decaprenylphosphoryl-D-2-keto erythro pentose reductase, equivalent to Q9CDA5|ML0108 putative oxidoreductase from Mycobacterium leprae (254 aa), FASTA scores: opt: 1458, E(): 1.6e-83, (89.0% identity in 254 aa overlap); and O05764 putative protein belonging to the short-chain alcohol dehydrogenase from Mycobacterium smegmatis (254 aa), FASTA scores: opt: 1412, E(): 1.2e-80, (85.05% identity in 254 aa overlap). Also highly similar to Q9KZA5|SC5G8.09c putative short-chain dehydrogenase from Streptomyces coelicolor (256 aa), FASTA scores: opt: 733, E(): 1.8e-38, (45.3% identity in 254 aa overlap); and P43168|YMP3_STRCO hypothetical oxidoreductase from Streptomyces coelicolor (251 aa), FASTA scores: opt: 623, E(): 1.2e-31, (42.15% identity in 254 aa overlap); and similar to various oxidoreductases (principally acetoacetyl-CoA reductases) e.g. P14697|PHBB_ALCEU acetoacetyl-CoA reductase (246 aa) from Alcaligenes eutrophus (Ralstonia eutropha) (246 aa) FASTA scores: opt: 264, E(): 2.3e-09, (29.9% identity in 204 aa overlap); P45375|PHBB_CHRVI acetoacetyl-CoA reductase from Chromatium vinosum (246 aa), FASTA scores: opt: 261, E(): 3.5e-09, (27.45% identity in 226 aa overlap); Q9RT30|DR1938 oxidoreductase (short-chain dehydrogenase/reductase family) from Deinococcus radiodurans (283 aa), FASTA scores: opt: 251, E(): 1.7e-08, (27.55% identity in 236 aa overlap); etc. Also similar to Q10681|YK73_MYCTU|Rv2073c|MT2133|MTCY49.12 putative short-chain type dehydrogenase/reductase from Mycobacterium tuberculosis (249 aa), FASTA scores: opt: 589, E(): 1.5e-29, (41.25% identity in 252 aa overlap). Contains PS00061 Short-chain dehydrogenases/reductases family signature. Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
| Functional category | Lipid metabolism |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011). |
| Operon | Rv3790, Rv3791, Rv3792, and Rv3793 are co-transcribed, by Northern blot (See Goude et al., 2008). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4237165 | 4237929 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3791|dprE2
MVLDAVGNPQTVLLLGGTSEIGLAICERYLHNSAARIVLACLPDDPRREDAAAAMKQAGARSVELIDFDALDTDSHPKMIEAAFSGGDVDVAIVAFGLLGDAEELWQNQRKAVQIAEINYTAAVSVGVLLAEKMRAQGFGQIIAMSSAAGERVRRANFVYGSTKAGLDGFYLGLSEALREYGVRVLVIRPGQVRTRMSAHLKEAPLTVDKEYVANLAVTASAKGKELVWAPAAFRYVMMVLRHIPRSIFRKLPI
Bibliography
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Xiong Y, Chalmers MJ, Gao FP, Cross TA and Marshall AG [2005]. Identification of Mycobacterium tuberculosis H37Rv integral membrane proteins by one-dimensional gel electrophoresis and liquid chromatography electrospray ionization tandem mass spectrometry. Proteomics
- Mikusová K et al. [2005]. Decaprenylphosphoryl arabinofuranose, the donor of the D-arabinofuranosyl residues of mycobacterial arabinan, is formed via a two-step epimerization of decaprenylphosphoryl ribose. Biochemistry
- Goude R et al. [2008]. The critical role of embC in Mycobacterium tuberculosis. Operon
- Makarov V et al. [2009]. Benzothiazinones kill Mycobacterium tuberculosis by blocking arabinan synthesis. Biochemistry
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant