Go to browser
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionTogether with DPRE2|Rv3791, catalyzes epimerization of decaprenylphosphoryl ribose (DPR) to decaprenylphosphoryl arabinose (DPA) in arabinan synthesis
ProductDecaprenylphosphoryl-D-2-keto erythro pentose reductase
CommentsRv3791, (MTCY13D12.25), len: 254 aa. DprE2, decaprenylphosphoryl-D-2-keto erythro pentose reductase, equivalent to Q9CDA5|ML0108 putative oxidoreductase from Mycobacterium leprae (254 aa), FASTA scores: opt: 1458, E(): 1.6e-83, (89.0% identity in 254 aa overlap); and O05764 putative protein belonging to the short-chain alcohol dehydrogenase from Mycobacterium smegmatis (254 aa), FASTA scores: opt: 1412, E(): 1.2e-80, (85.05% identity in 254 aa overlap). Also highly similar to Q9KZA5|SC5G8.09c putative short-chain dehydrogenase from Streptomyces coelicolor (256 aa), FASTA scores: opt: 733, E(): 1.8e-38, (45.3% identity in 254 aa overlap); and P43168|YMP3_STRCO hypothetical oxidoreductase from Streptomyces coelicolor (251 aa), FASTA scores: opt: 623, E(): 1.2e-31, (42.15% identity in 254 aa overlap); and similar to various oxidoreductases (principally acetoacetyl-CoA reductases) e.g. P14697|PHBB_ALCEU acetoacetyl-CoA reductase (246 aa) from Alcaligenes eutrophus (Ralstonia eutropha) (246 aa) FASTA scores: opt: 264, E(): 2.3e-09, (29.9% identity in 204 aa overlap); P45375|PHBB_CHRVI acetoacetyl-CoA reductase from Chromatium vinosum (246 aa), FASTA scores: opt: 261, E(): 3.5e-09, (27.45% identity in 226 aa overlap); Q9RT30|DR1938 oxidoreductase (short-chain dehydrogenase/reductase family) from Deinococcus radiodurans (283 aa), FASTA scores: opt: 251, E(): 1.7e-08, (27.55% identity in 236 aa overlap); etc. Also similar to Q10681|YK73_MYCTU|Rv2073c|MT2133|MTCY49.12 putative short-chain type dehydrogenase/reductase from Mycobacterium tuberculosis (249 aa), FASTA scores: opt: 589, E(): 1.5e-29, (41.25% identity in 252 aa overlap). Contains PS00061 Short-chain dehydrogenases/reductases family signature. Belongs to the short-chain dehydrogenases/reductases (SDR) family.
Functional categoryLipid metabolism
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the membrane fraction of M. tuberculosis H37Rv using nanoLC-MS/MS (See Xiong et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
OperonRv3790, Rv3791, Rv3792, and Rv3793 are co-transcribed, by Northern blot (See Goude et al., 2008).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS42371654237929+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3791|dprE2
MVLDAVGNPQTVLLLGGTSEIGLAICERYLHNSAARIVLACLPDDPRREDAAAAMKQAGARSVELIDFDALDTDSHPKMIEAAFSGGDVDVAIVAFGLLGDAEELWQNQRKAVQIAEINYTAAVSVGVLLAEKMRAQGFGQIIAMSSAAGERVRRANFVYGSTKAGLDGFYLGLSEALREYGVRVLVIRPGQVRTRMSAHLKEAPLTVDKEYVANLAVTASAKGKELVWAPAAFRYVMMVLRHIPRSIFRKLPI
      
Bibliography