Gene ML0112c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable lipopolysaccharide transport integral membrane ABC transporter RfbD |
| Comments | ML0112c, len: 276 aa. Probable rfbD, polysaccharide-transport integral membrane protein ABC transporter (see first citation below), involved in O-antigen/lipopolysaccharides (LPS) transport, highly similar to Rv3783|P72049|AL123456 rfbD, polysaccharide-transport integral membrane protein ABC transporter from M. tuberculosis (280 aa) Fasta scores: E(): 0, (84.3% identity in 280 aa overlap). Similar to RFBD_YEREN|Z18920 rfbD, O-antigen export system permease protein from Yersinia enterocolitica (259 aa)(see second citation below), Fasta scores: E(): 2.9e-32, (28.2% identity in 259 aa overlap); and to other membrane proteins involved in lipopolysaccharide transport. Contains Pfam match to entry PF01061 ABC2_membrane, ABC-2 type transporter. Belongs to the ABC-2 subfamily of integral membrane proteins. |
| Functional category | Cell wall and cell processes |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 152783 | 153613 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0112c|rfbD
MTFVDAAAQSRTLARARSDLIEGLHRHELWLHLGWQDIKQRYRRSVLGPFWITIATGTTSIAMGGLYSKLFHLDLSVHLPYVTLGLIIWNLINAAILEGAEVFVANEGLIKQLPTPLSVHVYRLVWRQTILFTHNIIIYLVVGILFPKPWSWADLSVFPALALVILNSVWVSLCFGILATRYRDIGPLLFSVVQLLFFITPIIWNDDALRQQGEGRWSSIVELNPLLHYLDIVRAPLLGAHQELRHWAVVVTLTAAGWLLAAFAMRQYRARVPYWV
Bibliography
No article yet recorded
