Gene Rv3783
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | May form an ATP-driven O-antigen/lipopolysaccharide export apparatus, in association with RFBE|Rv3781. Responsible for the translocation of the substrate across the membrane. |
| Product | Probable O-antigen/lipopolysaccharide transport integral membrane protein ABC transporter RfbD |
| Comments | Rv3783, (MTCY13D12.17), len: 280 aa. Probable rfbD, polysaccharide-transport integral membrane protein ABC transporter (see Braibant et al., 2000), involved in O-antigen/lipopolysaccharides (LPS) transport, equivalent to Q9CDA2|ML0112 putative ABC transporter component from Mycobacterium leprae (276 aa), FASTA scores: opt: 1646, E(): 4e-102, (84.3% identity in 280 aa overlap). Also highly similar to Q9PAF1|XF2567 ABC transporter permease protein from Xylella fastidiosa (267 aa), FASTA scores: opt: 723, E(): 7.6e-41, (41.3% identity in 259 aa overlap); and similar to others e.g. Q56902|RFBD_YEREN O-antigen export system permease protein from Yersinia enterocolitica (259 aa) (see Zhang et al., 1993), FASTA scores: opt: 566, E(): 2e-30, (28.05% identity in 264 aa overlap); Q06955|RFBH RFBH protein (involved in the export of lipopolysaccharide) (alias Q9KVA3|VC0246) lipopolysaccharide/O-antigen transport protein from Vibrio cholerae (257 aa), FASTA scores: opt: 358, E(): 1.3e-16, (24.4% identity in 258 aa overlap); Q9HTB8|WZM|PA5451 membrane subunit of a-band LPS efflux transporter from Pseudomonas aeruginosa (265 aa), FASTA scores: opt: 263, E(): 2.7e-10, (25.45% identity in 263 aa overlap); etc. Belongs to the ABC-2 subfamily of integral membrane proteins. |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction of M. tuberculosis H37Rv but not the culture filtrate or membrane protein fraction (See de Souza et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in CDC1551 strain (see Lamichhane et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4229258 | 4230100 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3783|rfbD
MTFMDAQASFQTQSRTLARVRGDLVDGFRRHELWLHLGWQDIKQRYRRSVLGPFWITIATGTTAVAMGGLYSKLFRLELSEHLPYVTLGLIVWNLINAAILDGAEVFVANEGLIKQLPAPLSVHVYRLVWRQMIFFAHNIVIYFVIAIIFPKPWSWADLSFLPALALIFLNCVWVSLCFGILATRYRDIGPLLFSVVQLLFFMTPIIWNDETLRRQGAGRWSSIVELNPLLHYLDIVRAPLLGAHQELRHWLVVLVLTVVGWMLAAFAMRQYRARVPYWV
Bibliography
- Zhang L et al. [1993]. Genetic organization and sequence of the rfb gene cluster of Yersinia enterocolitica serotype O:3: similarities to the dTDP-L-rhamnose biosynthesis pathway of Salmonella and to the bacterial polysaccharide transport systems. Homolog Sequence Mutant Function
- Braibant M et al. [2000]. The ATP binding cassette (ABC) transport systems of Mycobacterium tuberculosis. Review Secondary
- Lamichhane G et al. [2003]. A postgenomic method for predicting essential genes at subsaturation levels of mutagenesis: application to Mycobacterium tuberculosis. Mutant
- Målen H et al. [2010]. Definition of novel cell envelope associated proteins in Triton X-114 extracts of Mycobacterium tuberculosis H37Rv. Proteomics
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- de Souza GA et al. [2011]. Bacterial proteins with cleaved or uncleaved signal peptides of the general secretory pathway. Proteomics
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant
