Gene ML0113c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible L-rhamnosyltransferase |
| Comments | ML0113c, len: 283 aa. Possible L-rhamnosyltransferase (EC 2.4.1.-), highly similar to Rv3782|P72048 possible L-rhamnosyltransferase from M. tuberculosis (304 aa), FASTA scores: opt: 1583, E(): 9.3e-96, (81.6% identity in 277 aa overlap). Similar to Q8NTV4 predicted glycosyltransferases from Corynebacterium glutamicum ATCC (313 aa), FASTA scores: opt: 1170, E(): 4.4e-73, (63.1% identity in 279 aa overlap); and other putative transferases. Note that previously known as rfbE. |
| Functional category | Cell wall and cell processes |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 153663 | 154514 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0113c|ML0113c
VLSTQTRLPDHLIVVDNDGAEHSRVRDLVDGQPIPTTYLGSRKNLGGAGGFALGMLHALTLGADWVWLADDDGIPQDTRMLATLLACADKYGLAEVSPMVCSLDDPELLAFPLRRGLGWHRRASELRTKEGQDLLRGIASLFNGALFRASTLDSIGVPDMRLFIRGDEVELHRRLARSGLPFGTCLETIYLHPCGSDEFRPILGGRMHTQYPDDPIKRFFTYRNRGYLMAQPGLRKLVAQEWFRFSWFFLVIRRDPKGLREWIRLHRLGRRENFGKPDMRGSS
Bibliography
No article yet recorded