Gene Rv3782 (rfbE)
in Mycobacterium tuberculosis H37Rv
General annotation
| Type | CDS |
| Function | Transfers galactofuranose in the initiation of cell wall galactan polymerization |
| Product | UDP-galactofuranosyl transferase GlfT1 |
| Comments | Rv3782, (MTCY13D12.16), len: 304 aa. GlfT1, UDP-galactofuranosyl transferase (See Mikusova et al., 2006; Belanova et al., 2008), equivalent to Q9CDA1|RFBE|ML0113 putative glycosyl transferase from Mycobacterium leprae (283 aa), FASTA scores: opt: 1583, E(): 9.3e-96, (81.6% identity in 277 aa overlap). Also some similarity with AAK68916|WCFN putative glycosyltransferase from Bacteroides fragilis (291 aa) FASTA scores: opt: 241, E(): 2.1e-08, (30.75% identity in 195 aa overlap); O58161|PH0424 hypothetical 40.5 KDA protein from Pyrococcus horikoshii (348 aa), FASTA scores: opt: 194, E(): 2.8e-05, (23.85% identity in 302 aa overlap); O26448|MTH348 rhamnosyl transferase from Methanothermobacter thermautotrophicus (313 aa), FASTA scores: opt: 177, E(): 0.00033, (28.2% identity in 333 aa overlap); O07868|CPS19BQ putative rhamnosyl transferase FASTA from Streptococcus pneumoniae (300 aa), FASTA scores: opt: 156, E(): 0.0074, (25.45% identity in 232 aa overlap); and other putative transferases. Note that C-terminal end shows some similarity with part of Q05161|RFB O-antigen biosynthesis protein B from Escherichia coli strain 0101. Note that previously known as rfbE. |
| Functional category | Cell wall and cell processes |
| Proteomics | Identified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Translational start site supported by proteomics data (See Kelkar et al., 2011). |
| Mutant | Essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011). Check for mutants available at TARGET website |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 4228347 | 4229261 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv3782|glfT1
MTESVFAVVVTHRRPDELAKSLDVLTAQTRLPDHLIVVDNDGCGDSPVRELVAGQPIATTYLGSRRNLGGAGGFALGMLHALAQGADWVWLADDDGHAQDARVLATLLACAEKYSLAEVSPMVCNIDDPTRLAFPLRRGLVWRRRASELRTEAGQELLPGIASLFNGALFRASTLAAIGVPDLRLFIRGDEVEMHRRLIRSGLPFGTCLDAAYLHPCGSDEFKPILCGRMHAQYPDDPGKRFFTYRNRGYVLSQPGLRKLLAQEWLRFGWFFLVTRRDPKGLWEWIRLRRLGRREKFGKPGGSA
Bibliography
- Zhang L et al. [1993]. Genetic organization and sequence of the rfb gene cluster of Yersinia enterocolitica serotype O:3: similarities to the dTDP-L-rhamnose biosynthesis pathway of Salmonella and to the bacterial polysaccharide transport systems. Homolog Sequence Mutant Function
- Gu S et al. [2003]. Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Proteomics
- Sassetti CM et al. [2003]. Genes required for mycobacterial growth defined by high density mutagenesis. Mutant
- Mikusová K et al. [2006]. Identification of a novel galactosyl transferase involved in biosynthesis of the mycobacterial cell wall. Function Product
- Belánová M et al. [2008]. Galactosyl transferases in mycobacterial cell wall synthesis. Function Product
- Alderwick LJ et al. [2008]. Expression, purification and characterisation of soluble GlfT and the identification of a novel galactofuranosyltransferase Rv3782 involved in priming GlfT-mediated galactan polymerisation in Mycobacterium tuberculosis. Function
- Kelkar DS et al. [2011]. Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Proteomics Sequence
- Griffin JE et al. [2011]. High-resolution phenotypic profiling defines genes essential for mycobacterial growth and cholesterol catabolism. Mutant
- DeJesus MA et al. [2017]. Comprehensive Essentiality Analysis of the Mycobacterium tuberculosis Genome via Saturating Transposon Mutagenesis. Mutant
- Minato Y et al. [2019]. Genomewide Assessment of Mycobacterium tuberculosis Conditionally Essential Metabolic Pathways. Mutant