Gene ML0120c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Possible enoyl-CoA hydratase EchA21 (enoyl hydrase) (unsaturated acyl-coA hydratase) (crotonase) |
| Comments | ML0120c, len: 278 aa. Possible echA21, enoyl-CoA hydratase (EC 4.2.1.17), highly similar to Rv3774|P75019|AL123456 possible echA21, enoyl-CoA hydratase from M. tuberculosis (274 aa), Fasta scores: E(): 0, (88.3% identity in 274 aa overlap); and similar to many others e.g. ECH1_RAT|Q62651 ech1, delta3,5-delta2,4-dienoyl-coa isomerase precursor from Rattus norvegicus (327 aa), Fasta scores: E(): 3.5e-31, (38.8% identity in 276 aa overlap). Also shows some similarity to bacterial putative enoyl-CoA hydratases. And similar to ML1241, ML1724, ML2118 and ML2402 from M. leprae. Contains Pfam match to entry PF00378 ECH, Enoyl-CoA hydratase/isomerase family. |
| Functional category | Lipid metabolism |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 161741 | 162577 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0120c|echA1
MGSDINRAYESVAVEIKDRVAQVTLIGPGKGNAMGPAFWSEMPEVFAELDTNREVRAVVITGSGKDFSYGLDVPAMGGKFVPLLTDGALARPRTDFHAEVLRMQKAINAVADCRTPTIAAVHGWCIGGALDLISAVDIRYASADAKFSMREVKLAIVADMGSLARLPLILSDGHLRELALTGKDIDATRAEKIGLVNDVYDNADKTLAAAHATAAEIAANPPLAVYGVKDVLYQQRTSAISESLRYVAAWNAAFLPSKDLTEGISATFAKRAPQFIGE
Bibliography
No article yet recorded