Gene ML0130c
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable methyltransferase (Methylase) |
| Comments | ML0130c, len: 270 aa. Probable methyltransferase (EC 2.1.1.-), highly similar to Rv2952|Q50464|AL123456 probable methyltransferase from M. tuberculosis (270 aa), Fasta scores: E(): 0, (83.7% identity in 270 aa overlap); and similar to Q9RMN9 putative methyltransferase from Mycobacterium smegmatis (274 aa), Fasta scores: E(): 0, (50.6% identity in 257 aa overlap). Similar in part to Q54303|X86780 rapM, methyltransferase involved in rapamycin biosynthesis from Streptomyces hygroscopicus (317 aa), Fasta scores: E(): 5e-14, (38.6% identity in 158 aa overlap). Also similar to ML1881c a possible pseudogene similar to M. tuberculosis Rv2952. |
| Functional category | Intermediary metabolism and respiration |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 174466 | 175278 | - |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0130c|ML0130c
MAFTRIHSFLASAGNTSMYKRVWRFWYPLMTHKLGTDEIMFINWAYEEDPPMALPLEASDEPNRAHINLYHRTATQVNLSGKRILEVSCGHGGGASYLTRALHPASYTGLDLNPAGIKLCQKRHQLPGLEFVRGDAENLPFDNESFDVVINIEASHCYPHFPRFLAEVVRVLRPGGHLAYADLRPSNKVGEWEVDFANSRLQQLSQREINAEVLRGIASNSQKSRDLVDRHLPAFLRFAGREFIGVQGTQLSRYLEGGELSYRMYSFAKD
Bibliography
No article yet recorded
