Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionThought to cause methylation.
ProductPossible methyltransferase (methylase)
CommentsRv2952, (MTCY349.38), len: 270 aa. Probable methyltransferase, equivalent to Q9CD86|ML0130 hypothetical protein from Mycobacterium leprae (270 aa), FASTA scores: opt: 1584, E(): 6.1e-99, (83.7% identity in 270 aa overlap). Also highly similar to Q9RMN9|MTF2 putative methyltransferase from Mycobacterium smegmatis (274 aa), FASTA scores: opt: 902, E(): 3.8e-53, (56.35% identity in 252 aa overlap). Also similar to other methyltransferases e.g. Q9ADL4|SORM O-methyltransferase from Polyangium cellulosum (346 aa), FASTA scores: opt: 390, E(): 1.1e-18, (36.25% identity in 251 aa overlap); Q54303|RAPM methyltransferase from Streptomyces hygroscopicus (317 aa), FASTA scores: opt: 315, E(): 1.1e-13, (40.75% identity in 135 aa overlap); etc. Very similar to C-terminal part of Q50584|Rv1523|MTCY19G5.05c hypothetical 37.9 KDA protein from Mycobacterium tuberculosis (358 aa), FASTA score: opt: 965, E(): 2.7e-57, (60.3% identity in 247 aa overlap).
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified in the membrane fraction of M. tuberculosis H37Rv using 1D-SDS-PAGE and uLC-MS/MS (See Gu et al., 2003). Identified in the cell membrane fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified in the detergent phase of Triton X-114 extracts of M. tuberculosis H37Rv membranes using 1-DGE, CEGE, and MALDI-TOF-MS (See Sinha et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the membrane protein fraction and whole cell lysates of M. tuberculosis H37Rv but not the culture filtrate (See de Souza et al., 2011).
TranscriptomicsmRNA identified by microarray analysis and down-regulated after 24h of starvation (see citation below).
MutantNon-essential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Non-essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Non essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Non-essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS33044413305253+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv2952|Rv2952
MAFSRTHSLLARAGSTSTYKRVWRYWYPLMTRGLGNDEIVFINWAYEEDPPMDLPLEASDEPNRAHINLYHRTATQVDLGGKQVLEVSCGHGGGASYLTRTLHPASYTGLDLNQAGIKLCKKRHRLPGLDFVRGDAENLPFDDESFDVVLNVEASHCYPHFRRFLAEVVRVLRPGGYFPYADLRPNNEIAAWEADLAATPLRQLSQRQINAEVLRGIGNNSQKSRDLVDRHLPAFLRFAGREFIGVQGTQLSRYLEGGELSYRMYCFTKD