Gene ML0133
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Conserved hypothetical protein |
| Comments | ML0133, len: 210 aa. Conserved hypothetical protein, similar to Rv2949c|O86325|AL123456 conserved hypothetical protein from M. tuberculosis (199 aa), Fasta scores: E(): 0, (62.6% identity in 195 aa overlap). Shows weak similarity to O28875|AE001008 hypothetical protein AF1396 from Archaeoglobus fulgidus (162 aa), Fasta scores: E(): 4.2e-05, (26.6% identity in 154 aa overlap). Contains Pfam match to entry PF01947 DUF98, protein of unknown function. |
| Functional category | Conserved hypotheticals, Intermediary metabolism and respiration |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 179256 | 179888 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0133|ML0133
MTNRTLSREEIRKLDRDLRILVATNGTLTRVLNVVANEEIVVDIINQQLLDVAPKIPELENLKIGRILQRDILLKGQKSGILFVAAESLIVIDLLPTAITTYLTKTHHPIGEIMAASRIETYKEDAQVWIGDLPCWLADYGYWDLPKRAVGRRYRIIAGGQPVIITTEYFLRSVFQDTPREELDRCQYSNDIDTRSGDRFVLHGRVFKNL
Bibliography
No article yet recorded