Gene ML0155
in Mycobacterium leprae TN
General annotation
| Type | CDS |
| Function | Unknown |
| Product | Probable succinyl-CoA synthase, (beta chain) SucC (SCS-beta) |
| Comments | ML0155, len: 393 aa. Probable sucC, succinyl-CoA synthetase, beta chain (EC 6.2.1.5), highly similar to Rv0951|SUCC_MYCTU|P71559 sucC, succinyl-CoA synthetase beta chain from M. tuberculosis (387 aa), Fasta scores: E(): 0, (86.7% identity in 391 aa overlap). Similar to many e.g. SUCC_THEFL|P25126 sucC, succinyl-CoA synthase beta chain from Thermus aquaticus (378 aa), Fasta scores: E(): 0, (48.7% identity in 384 aa overlap). Previously sequenced as Q9Z5H8 |AL035500 (393 aa), Fasta scores: E(): 0, (100.0% identity in 393 aa overlap). Contains Pfam match to entry PF00549 ligase-CoA, CoA-ligases. Contains Pfam match to entry PF02222 ATP-grasp, ATP-grasp domain. Contains PS01217 ATP-citrate lyase / succinyl-CoA ligases family signature 3. |
| Functional category | Intermediary metabolism and respiration |
Coordinates
| Type | Start | End | Orientation |
|---|---|---|---|
| CDS | 218458 | 219639 | + |
Genomic sequence
Feature type
Upstream flanking region (bp)
Downstream flanking region (bp)
Update
Protein sequence
>Mycobacterium leprae TN|ML0155|sucC
MDLFEYQAKELFAKHGVPGIQGRVTDSAEGAKTIAMEIGRPVMVKAQVKTGGRGKAGGVKYAATPEEAYQQAKNILGLDIKGHIVKKLLVVEASDIAEEYYLSFLLDRANRTYLAMCSVEGGMEIEEVAATKPERLAKVSVDAVKGVDLACARSIAQQGHLPAEVLDAAAATIAKLWELFVAEDATLVEVNPLVRTPSRGYGSSGKILALDGKVTLDANARFRQPGHAEFEDRAATDPLEWKAKQHNLNYIKLDGEVGIIGNGAGLTMSTFDVVAYAGEQHGGVKPANFLDIGGGASAEVMAASLDVVLGDVQVKSVFVNIFGGITTCDTVATGIVKALEILGDEANKPLVVRLDGNNVGEGRRILAEANHPLVMLVPTMDEAANKAAELART
Bibliography
No article yet recorded
