Go to browser
virulence, detoxification, adaptation
information pathways
cell wall and cell processes
stable RNAs
insertion seqs and phages
PE/PPE
intermediary metabolism and respiration
unknown
regulatory proteins
conserved hypotheticals
lipid metabolism
pseudogenes
General annotation
TypeCDS
FunctionInvolved in tricarboxylic acid cycle [catalytic activity: ATP + succinate + CoA = ADP + succinyl-CoA + phosphate].
ProductProbable succinyl-CoA synthetase (beta chain) SucC (SCS-beta)
CommentsRv0951, (MTCY10D7.23c), len: 387 aa. Probable sucC, succinyl-CoA synthetase, beta chain, equivalent to AL035500|MLCL373_3|NP_301241.1|NC_002677 succinyl-CoA synthase [beta] chain from Mycobacterium leprae (393 aa), FASTA score: (86.7% identity in 391 aa overlap). Also highly similar to others e.g. AB92671.1|AL356832 succinyl-CoA synthetase beta chain from Streptomyces coelicolor (394 aa); P25126|SUCC_THEFL succinyl-CoA synthetase beta chain from Thermus aquaticus (378 aa); P07460|SUCC_ECOLI succinyl-CoA synthetase beta chain from Escherichia coli (388 aa), FASTA scores: opt: 933, E(): 0, (41.0% identity in 390 aa overlap); etc.
Functional categoryIntermediary metabolism and respiration
ProteomicsIdentified in the cytosol and cell wall fraction of M. tuberculosis H37Rv using 2DLC/MS (See Mawuenyega et al., 2005). Identified by mass spectrometry in Triton X-114 extracts of M. tuberculosis H37Rv (See Malen et al., 2010). Identified by mass spectrometry in the culture filtrate, membrane protein fraction, and whole cell lysates of M. tuberculosis H37Rv (See de Souza et al., 2011). Translational start site supported by proteomics data (See de Souza et al., 2011) (See Kelkar et al., 2011).
MutantEssential gene for in vitro growth of H37Rv in a MtbYM rich medium, by Himar1 transposon mutagenesis (see Minato et al. 2019). Essential gene for in vitro growth of H37Rv, by analysis of saturated Himar1 transposon libraries (see DeJesus et al. 2017). Essential gene by Himar1 transposon mutagenesis in H37Rv strain (see Sassetti et al., 2003). Essential gene for in vitro growth of H37Rv, by Himar1 transposon mutagenesis (See Griffin et al., 2011).
Check for mutants available at TARGET website
Coordinates
TypeStartEndOrientation
CDS10619641063127+
Genomic sequence
Feature type Upstream flanking region (bp) Downstream flanking region (bp) Update
       
Protein sequence
>Mycobacterium tuberculosis H37Rv|Rv0951|sucC
MDLFEYQAKELFAKHNVPSTPGRVTDTAEGAKAIATEIGRPVMVKAQVKIGGRGKAGGVKYAATPQDAYEHAKNILGLDIKGHIVKKLLVAEASDIAEEYYLSFLLDRANRTYLAMCSVEGGMEIEEVAATKPERLAKVPVNAVKGVDLDFARSIAEQGHLPAEVLDTAAVTIAKLWELFVAEDATLVEVNPLVRTPDHKILALDAKITLDGNADFRQPGHAEFEDRAATDPLELKAKEHDLNYVKLDGQVGIIGNGAGLVMSTLDVVAYAGEKHGGVKPANFLDIGGGASAEVMAAGLDVVLGDQQVKSVFVNVFGGITSCDAVATGIVKALGMLGDEANKPLVVRLDGNNVEEGRRILTEANHPLVTLVATMDEAADKAAELASA
      
Bibliography